Nitrosococcus halophilus: Nhal_1857 Help Entry Nhal_1857         CDS       T01198                                  Name (GenBank) MbtH domain protein   KO K05375   MbtH protein Organism nhl  Nitrosococcus halophilus Pathway nhl00261   Monobactam biosynthesis nhl01100   Metabolic pathways nhl01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:nhl00001]  09100 Metabolism   09110 Biosynthesis of other secondary metabolites    00261 Monobactam biosynthesis     Nhal_1857  09180 Brite Hierarchies   09181 Protein families: metabolism    01008 Polyketide biosynthesis proteins [BR:nhl01008]     Nhal_1857 Polyketide biosynthesis proteins [BR:nhl01008]  Nonribosomal peptide synthetase (NRPS)   Linear NRPS    Nocardicin synthetase     Nhal_1857 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  MbtH Motif Other DBs NCBI-ProteinID:  ADE14975 UniProt:  D5C367 LinkDB All DBs Position 1910693..1910947 Genome browser AA seq 84 aa AA seqDB search MNWDEEKEAIFYRVITDGDRQYSIWPEDRAIPKGWHTTGEVGSKEECFDYIKEIWLQMSP LNHGKSFVEESNSNGRDFLKRERL NT seq 255 nt NT seq  +upstreamnt  +downstreamnt atgaattgggatgaagagaaagaggcaatattttatcgtgtgattacggatggtgatagg caatattcgatctggccagaggacagggccatccccaagggatggcatactaccggggaa gtggggagcaaagaagaatgctttgattacatcaaggaaatatggctccaaatgagtcct ttgaaccatggtaaatcatttgtggaggaatctaatagcaatggcagagattttctaaaa agagaaagactgtag

DBGET integrated database retrieval system