Nocardia huaxiensis: H0264_03415 Help Entry H0264_03415       CDS       T07784                                  Symbol folB Name (GenBank) dihydroneopterin aldolase   KO K01633   7,8-dihydroneopterin aldolase/epimerase/oxygenase [EC:4.1.2.25 5.1.99.8 1.13.11.81] Organism nhu  Nocardia huaxiensis Pathway nhu00790   Folate biosynthesis nhu01100   Metabolic pathways nhu01240   Biosynthesis of cofactors Module nhu_M00126   Tetrahydrofolate biosynthesis, GTP => THF Brite KEGG Orthology (KO) [BR:nhu00001]  09100 Metabolism   09108 Metabolism of cofactors and vitamins    00790 Folate biosynthesis     H0264_03415 (folB) Enzymes [BR:nhu01000]  1. Oxidoreductases   1.13  Acting on single donors with incorporation of molecular oxygen (oxygenases)    1.13.11  With incorporation of two atoms of oxygen     1.13.11.81  7,8-dihydroneopterin oxygenase      H0264_03415 (folB)  4. Lyases   4.1  Carbon-carbon lyases    4.1.2  Aldehyde-lyases     4.1.2.25  dihydroneopterin aldolase      H0264_03415 (folB)  5. Isomerases   5.1  Racemases and epimerases    5.1.99  Acting on other compounds     5.1.99.8  7,8-dihydroneopterin epimerase      H0264_03415 (folB) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  FolB Motif Other DBs NCBI-ProteinID:  QLY31414 UniProt:  A0A7D6VBD9 LinkDB All DBs Position 753679..754056 Genome browser AA seq 125 aa AA seqDB search MSTDRIELRGLKIYGHHGVFDFEKRDGQEFVVDVTLWTDFSAAAKSDDISDTIHYGELAD DVVRIVSGQPRNLIETVVSELADEIMGDPRVHAVEVVLHKPSAPIPHTFEDVRVITSRRR EVPSS NT seq 378 nt NT seq  +upstreamnt  +downstreamnt ttgagcactgaccggattgagctgcgggggctgaagatctatggccatcacggagtcttc gatttcgagaagcgggacggccaggaattcgtggtcgatgtgacgctgtggaccgacttt tcggccgcggcgaaatccgatgacatctccgacaccattcattacggcgagctggccgat gacgtggtgcggatcgtgtcgggacagccgcggaatctgatcgagacggtggtgtcggag ctggccgacgagatcatgggggatccgcgggtgcacgcggtggaagtggtgctgcacaag ccttccgcgccgattccgcataccttcgaggatgttcgcgtgatcacgtctcgtcgtcgt gaggtcccgtcgtcgtga

DBGET integrated database retrieval system