Nocardia huaxiensis: H0264_09125 Help Entry H0264_09125       CDS       T07784                                  Name (GenBank) MbtH family protein   KO K05375   MbtH protein Organism nhu  Nocardia huaxiensis Pathway nhu00261   Monobactam biosynthesis nhu01100   Metabolic pathways nhu01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:nhu00001]  09100 Metabolism   09110 Biosynthesis of other secondary metabolites    00261 Monobactam biosynthesis     H0264_09125  09180 Brite Hierarchies   09181 Protein families: metabolism    01008 Polyketide biosynthesis proteins [BR:nhu01008]     H0264_09125 Polyketide biosynthesis proteins [BR:nhu01008]  Nonribosomal peptide synthetase (NRPS)   Linear NRPS    Nocardicin synthetase     H0264_09125 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  MbtH Motif Other DBs NCBI-ProteinID:  QLY32392 UniProt:  A0A7D6VBH5 LinkDB All DBs Position 2040780..2040995 Genome browser AA seq 71 aa AA seqDB search MSNPFDDEDAQFYVLVNDEAQHSLWPVFAAVPGGWSIAHGPARRQDCLEYVECHWTDMRP KSLIEEMAEAE NT seq 216 nt NT seq  +upstreamnt  +downstreamnt atgagcaatcccttcgacgacgaagacgctcagttctatgtgctggtcaacgacgaggca cagcactcgctgtggccggtgttcgccgccgtgcccggcggctggagcatcgcccacgga ccggcacgccgacaggactgcctcgagtacgtggagtgccattggaccgacatgcggccc aagtcgctgatcgaggaaatggccgaagccgaatag

DBGET integrated database retrieval system