Nibribacter ruber: GU926_16080 Help Entry GU926_16080       CDS       T06388                                  Symbol folB Name (GenBank) dihydroneopterin aldolase   KO K01633   7,8-dihydroneopterin aldolase/epimerase/oxygenase [EC:4.1.2.25 5.1.99.8 1.13.11.81] Organism nib  Nibribacter ruber Pathway nib00790   Folate biosynthesis nib01100   Metabolic pathways nib01240   Biosynthesis of cofactors Module nib_M00126   Tetrahydrofolate biosynthesis, GTP => THF Brite KEGG Orthology (KO) [BR:nib00001]  09100 Metabolism   09108 Metabolism of cofactors and vitamins    00790 Folate biosynthesis     GU926_16080 (folB) Enzymes [BR:nib01000]  1. Oxidoreductases   1.13  Acting on single donors with incorporation of molecular oxygen (oxygenases)    1.13.11  With incorporation of two atoms of oxygen     1.13.11.81  7,8-dihydroneopterin oxygenase      GU926_16080 (folB)  4. Lyases   4.1  Carbon-carbon lyases    4.1.2  Aldehyde-lyases     4.1.2.25  dihydroneopterin aldolase      GU926_16080 (folB)  5. Isomerases   5.1  Racemases and epimerases    5.1.99  Acting on other compounds     5.1.99.8  7,8-dihydroneopterin epimerase      GU926_16080 (folB) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  FolB Motif Other DBs NCBI-ProteinID:  QHL88863 UniProt:  A0A6P1P3A4 LinkDB All DBs Position 3803809..3804165 Genome browser AA seq 118 aa AA seqDB search MGQVALEGMEFFAFHGFSDEEQKIGNRYGVDISIETDLQAAAVSDDLQDTVNYVTLYQLV QQEMAVPARLLEHVGHRIMERVFQAFPFVQLARVSVSKFNPPLGGICHKSKVTLERKR NT seq 357 nt NT seq  +upstreamnt  +downstreamnt atggggcaagtggcactggaaggcatggagttttttgcctttcatggattctctgacgag gagcagaaaataggaaaccgctacggtgtagacatctccattgagacagacttacaagcc gccgccgtttctgatgacctgcaagacaccgtgaactatgtaacgctgtaccaactggtg caacaggagatggcggttcccgcgcggttgttagaacacgtggggcatagaatcatggag cgggtctttcaggcatttccgtttgtgcagctggcccgggtgagcgtctccaaattcaat ccaccactgggaggcatctgccacaagtctaaagtcaccctggaacgaaagcgataa

DBGET integrated database retrieval system