Nocardia iowensis: KV110_03355 Help Entry KV110_03355       CDS       T07470                                  Name (GenBank) MbtH family protein   KO K05375   MbtH protein Organism nie  Nocardia iowensis Pathway nie00261   Monobactam biosynthesis nie01100   Metabolic pathways nie01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:nie00001]  09100 Metabolism   09110 Biosynthesis of other secondary metabolites    00261 Monobactam biosynthesis     KV110_03355  09180 Brite Hierarchies   09181 Protein families: metabolism    01008 Polyketide biosynthesis proteins [BR:nie01008]     KV110_03355 Polyketide biosynthesis proteins [BR:nie01008]  Nonribosomal peptide synthetase (NRPS)   Linear NRPS    Nocardicin synthetase     KV110_03355 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  MbtH Motif Other DBs NCBI-ProteinID:  QXN95305 LinkDB All DBs Position 700952..701194 Genome browser AA seq 80 aa AA seqDB search MSTNPFDDEDGRFFVLVNDEEQHSLWPAFAEVPAGWRVVFGEDSRAACVEYVEKNWTDMR PKSLRDAMAADDAARQGAQS NT seq 243 nt NT seq  +upstreamnt  +downstreamnt ttgagcaccaaccccttcgatgatgaggacggccgcttcttcgtcctggtcaacgacgaa gaacagcactccctgtggcctgccttcgcggaggtcccggccggatggcgagtcgtgttc ggcgaggacagccgcgccgcatgcgtcgaatacgtcgagaagaactggacggatatgcgt ccgaagagcctgcgtgacgcgatggccgcggacgacgcggcccgtcagggcgcccagtcc tga

DBGET integrated database retrieval system