Nitrincola iocasae: F5I99_04425 Help Entry F5I99_04425       CDS       T06212                                  Symbol folB Name (GenBank) dihydroneopterin aldolase   KO K01633   7,8-dihydroneopterin aldolase/epimerase/oxygenase [EC:4.1.2.25 5.1.99.8 1.13.11.81] Organism nik  Nitrincola iocasae Pathway nik00790   Folate biosynthesis nik01100   Metabolic pathways nik01240   Biosynthesis of cofactors Brite KEGG Orthology (KO) [BR:nik00001]  09100 Metabolism   09108 Metabolism of cofactors and vitamins    00790 Folate biosynthesis     F5I99_04425 (folB) Enzymes [BR:nik01000]  1. Oxidoreductases   1.13  Acting on single donors with incorporation of molecular oxygen (oxygenases)    1.13.11  With incorporation of two atoms of oxygen     1.13.11.81  7,8-dihydroneopterin oxygenase      F5I99_04425 (folB)  4. Lyases   4.1  Carbon-carbon lyases    4.1.2  Aldehyde-lyases     4.1.2.25  dihydroneopterin aldolase      F5I99_04425 (folB)  5. Isomerases   5.1  Racemases and epimerases    5.1.99  Acting on other compounds     5.1.99.8  7,8-dihydroneopterin epimerase      F5I99_04425 (folB) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  FolB Motif Other DBs NCBI-ProteinID:  QEW05793 UniProt:  A0A5J6LB87 LinkDB All DBs Position 932735..933091 Genome browser AA seq 118 aa AA seqDB search MDIVYIRGLQVETVIGIYDWEREVRQCVCVDLDLGTDIRAAAHADDIDSTLNYKSISDRL IAFISGSEFLLIEALAEEIASLLMDEFSVPWLRLQLGKPGAVPEARDVGIIIERGEKR NT seq 357 nt NT seq  +upstreamnt  +downstreamnt atggatatagtgtacattcgtgggttgcaggtggaaacggttatcggaatatacgactgg gagcgtgaagtccgccagtgcgtttgcgtcgatcttgatctgggtactgatattcgtgcg gctgcgcatgcggatgatattgatagtaccctgaactataaaagcattagtgatcgactg attgcatttatatccggtagtgagtttttattgattgaagccctggcagaagagattgct tcgttgttgatggatgagttttccgtgccctggttgcgcttgcagttgggtaagccaggc gcagtgcctgaagcacgtgatgttggcattattattgaacgtggagaaaaacgctga

DBGET integrated database retrieval system