Candidatus Nitrotoga sp. AM1P: W01_00950 Help Entry W01_00950         CDS       T06613                                  Symbol folB Name (GenBank) 7,8-dihydroneopterin aldolase   KO K01633   7,8-dihydroneopterin aldolase/epimerase/oxygenase [EC:4.1.2.25 5.1.99.8 1.13.11.81] Organism nim  Candidatus Nitrotoga sp. AM1P Pathway nim00790   Folate biosynthesis nim01100   Metabolic pathways nim01240   Biosynthesis of cofactors Module nim_M00126   Tetrahydrofolate biosynthesis, GTP => THF Brite KEGG Orthology (KO) [BR:nim00001]  09100 Metabolism   09108 Metabolism of cofactors and vitamins    00790 Folate biosynthesis     W01_00950 (folB) Enzymes [BR:nim01000]  1. Oxidoreductases   1.13  Acting on single donors with incorporation of molecular oxygen (oxygenases)    1.13.11  With incorporation of two atoms of oxygen     1.13.11.81  7,8-dihydroneopterin oxygenase      W01_00950 (folB)  4. Lyases   4.1  Carbon-carbon lyases    4.1.2  Aldehyde-lyases     4.1.2.25  dihydroneopterin aldolase      W01_00950 (folB)  5. Isomerases   5.1  Racemases and epimerases    5.1.99  Acting on other compounds     5.1.99.8  7,8-dihydroneopterin epimerase      W01_00950 (folB) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  FolB Motif Other DBs NCBI-ProteinID:  BBJ22168 UniProt:  A0A455X029 LinkDB All DBs Position complement(111352..111693) Genome browser AA seq 113 aa AA seqDB search MAHTLAHDGITLYTLIGVYEWERAASRPLVFNLRLESAHPLGLTRTLIERQLAGWLAPCR YRLLEALAEHIAQRMLMEWHCSRVEIGIEKPGALGDLARVGIRIMRDAEKRAA NT seq 342 nt NT seq  +upstreamnt  +downstreamnt atggcgcacacgctcgcacatgatggaattactttgtataccctcatcggcgtgtacgaa tgggaacgggcagcctcacgtccgctcgtttttaatttacggctagaaagtgcacacccg cttggcctgacacgtacgcttattgagcggcagcttgccggttggcttgcaccctgccgc tatcgattgctggaagctttggcagaacacatcgctcaacgcatgttaatggaatggcat tgcagtcgggtcgagattggcatcgaaaaacctggtgcattaggcgatctggcgcgcgtt ggcatacgtattatgagggatgcggaaaagcgagctgcgtaa

DBGET integrated database retrieval system