Candidatus Nitrotoga sp. AM1P: W01_20630 Help Entry W01_20630         CDS       T06613                                  Name (GenBank) 7,8-dihydroneopterin aldolase   KO K01633   7,8-dihydroneopterin aldolase/epimerase/oxygenase [EC:4.1.2.25 5.1.99.8 1.13.11.81] Organism nim  Candidatus Nitrotoga sp. AM1P Pathway nim00790   Folate biosynthesis nim01100   Metabolic pathways nim01240   Biosynthesis of cofactors Module nim_M00126   Tetrahydrofolate biosynthesis, GTP => THF Brite KEGG Orthology (KO) [BR:nim00001]  09100 Metabolism   09108 Metabolism of cofactors and vitamins    00790 Folate biosynthesis     W01_20630 Enzymes [BR:nim01000]  1. Oxidoreductases   1.13  Acting on single donors with incorporation of molecular oxygen (oxygenases)    1.13.11  With incorporation of two atoms of oxygen     1.13.11.81  7,8-dihydroneopterin oxygenase      W01_20630  4. Lyases   4.1  Carbon-carbon lyases    4.1.2  Aldehyde-lyases     4.1.2.25  dihydroneopterin aldolase      W01_20630  5. Isomerases   5.1  Racemases and epimerases    5.1.99  Acting on other compounds     5.1.99.8  7,8-dihydroneopterin epimerase      W01_20630 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  FolB Motif Other DBs NCBI-ProteinID:  BBJ24136 UniProt:  A0A455XF24 LinkDB All DBs Position 2332906..2333268 Genome browser AA seq 120 aa AA seqDB search MDIIFLRELKVETLIGVYEWEKRVPQTLQLDMEIALPNARACQSDDIHDALDYSEIVRHI QSALSNHHFNLLEALAERIAQILLIDFNVPWVKVSVAKLNAIRDSRMVGISIERRQAKSN NT seq 363 nt NT seq  +upstreamnt  +downstreamnt atggatattatttttctacgcgaactcaaagttgaaacgctcattggtgtatacgaatgg gagaagcgtgttccgcaaactttgcagctagatatggagattgccttgccaaatgctcgc gcctgtcagagtgacgatatacacgatgcacttgattactccgaaattgtgcgtcacatc caaagcgcgctaagtaaccaccacttcaacctgctagaagcactggccgaacgcattgcc cagattctgcttattgatttcaacgtgccatgggtcaaagttagcgttgccaaattaaat gccatacgtgacagtcgcatggtgggcatcagcattgaacgcaggcaggctaaatcaaac tga

DBGET integrated database retrieval system