Nitratireductor mangrovi: FQ775_16895 Help Entry FQ775_16895       CDS       T06518                                  Symbol folB Name (GenBank) dihydroneopterin aldolase   KO K01633   7,8-dihydroneopterin aldolase/epimerase/oxygenase [EC:4.1.2.25 5.1.99.8 1.13.11.81] Organism niy  Nitratireductor mangrovi Pathway niy00790   Folate biosynthesis niy01100   Metabolic pathways niy01240   Biosynthesis of cofactors Module niy_M00126   Tetrahydrofolate biosynthesis, GTP => THF Brite KEGG Orthology (KO) [BR:niy00001]  09100 Metabolism   09108 Metabolism of cofactors and vitamins    00790 Folate biosynthesis     FQ775_16895 (folB) Enzymes [BR:niy01000]  1. Oxidoreductases   1.13  Acting on single donors with incorporation of molecular oxygen (oxygenases)    1.13.11  With incorporation of two atoms of oxygen     1.13.11.81  7,8-dihydroneopterin oxygenase      FQ775_16895 (folB)  4. Lyases   4.1  Carbon-carbon lyases    4.1.2  Aldehyde-lyases     4.1.2.25  dihydroneopterin aldolase      FQ775_16895 (folB)  5. Isomerases   5.1  Racemases and epimerases    5.1.99  Acting on other compounds     5.1.99.8  7,8-dihydroneopterin epimerase      FQ775_16895 (folB) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  FolB DinI Motif Other DBs NCBI-ProteinID:  QDZ01918 UniProt:  A0A5B8L2Z7 LinkDB All DBs Position 1247920..1248279 Genome browser AA seq 119 aa AA seqDB search MYVIRMMNCAFFARHGVLDEEEMLGQRFYVDAVLTVDPDGALERDDITDTVDYGVAFKEI EEVITGKRRFLIEALARDVATRLCDRFPQIQRAEITVRKPNAPVPGVLDHVEVTVVWPQ NT seq 360 nt NT seq  +upstreamnt  +downstreamnt atgtatgtgatccgcatgatgaactgcgctttcttcgcgcgccatggcgtcctcgacgag gaggagatgctgggccagcgcttctatgtcgacgcggtgctgacggtcgatcccgacggt gcgctcgagcgggacgacatcaccgacacggtcgactacggcgtcgccttcaaggagatc gaggaagtgatcaccggcaagcgtcgcttcctcatcgaggcgctggcgcgcgacgtcgcg acaaggctttgcgatcgttttccgcagatccagcgcgccgaaatcacggtgcgcaagccg aacgcgccggtgcccggcgtgctcgaccatgtggaggtgacggttgtctggccgcagtga

DBGET integrated database retrieval system