Nitrosospira lacus: EBAPG3_013330 Help Entry EBAPG3_013330     CDS       T04907                                  Symbol folB Name (GenBank) dihydroneopterin aldolase   KO K01633   7,8-dihydroneopterin aldolase/epimerase/oxygenase [EC:4.1.2.25 5.1.99.8 1.13.11.81] Organism nlc  Nitrosospira lacus Pathway nlc00790   Folate biosynthesis nlc01100   Metabolic pathways nlc01240   Biosynthesis of cofactors Module nlc_M00126   Tetrahydrofolate biosynthesis, GTP => THF Brite KEGG Orthology (KO) [BR:nlc00001]  09100 Metabolism   09108 Metabolism of cofactors and vitamins    00790 Folate biosynthesis     EBAPG3_013330 (folB) Enzymes [BR:nlc01000]  1. Oxidoreductases   1.13  Acting on single donors with incorporation of molecular oxygen (oxygenases)    1.13.11  With incorporation of two atoms of oxygen     1.13.11.81  7,8-dihydroneopterin oxygenase      EBAPG3_013330 (folB)  4. Lyases   4.1  Carbon-carbon lyases    4.1.2  Aldehyde-lyases     4.1.2.25  dihydroneopterin aldolase      EBAPG3_013330 (folB)  5. Isomerases   5.1  Racemases and epimerases    5.1.99  Acting on other compounds     5.1.99.8  7,8-dihydroneopterin epimerase      EBAPG3_013330 (folB) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  FolB Motif Other DBs NCBI-ProteinID:  ARO88670 UniProt:  A0A1W6SS72 LinkDB All DBs Position 2922754..2923122 Genome browser AA seq 122 aa AA seqDB search MDIIFLQELKVKTLIGIYPWERTIAQTIQLDLEVAMPASKACQTDNFEDALDYAFIVQRI NETLSQKHFSLLEALAEHIAQIILKEFKSPWVKVSVAKLSAIRGVKKLGVCIERRLEANS SI NT seq 369 nt NT seq  +upstreamnt  +downstreamnt atggacatcattttcctgcaagaactcaaggtcaaaacattgattggcatttatccatgg gaacgcactatcgcgcagaccatccagctcgatctggaagttgcgatgcctgcgagcaag gcctgccaaacagacaatttcgaggacgcgctggattatgcctttattgtccaacgcatc aacgaaaccctgtcacaaaaacatttctctcttctggaagcgctggctgagcacatcgca caaattatcctgaaagaatttaaatcgccgtgggtcaaggtcagcgtggcgaaactcagt gcaatacgcggcgtaaaaaaattgggggtatgcatcgagcgccggctggaggcgaactca tctatttga

DBGET integrated database retrieval system