Nonlabens marinus: NMS_0822 Help Entry NMS_0822          CDS       T09770                                  Name (GenBank) dihydroneopterin aldolase   KO K01633   7,8-dihydroneopterin aldolase/epimerase/oxygenase [EC:4.1.2.25 5.1.99.8 1.13.11.81] Organism nmf  Nonlabens marinus Pathway nmf00790   Folate biosynthesis nmf01100   Metabolic pathways nmf01240   Biosynthesis of cofactors Brite KEGG Orthology (KO) [BR:nmf00001]  09100 Metabolism   09108 Metabolism of cofactors and vitamins    00790 Folate biosynthesis     NMS_0822 Enzymes [BR:nmf01000]  1. Oxidoreductases   1.13  Acting on single donors with incorporation of molecular oxygen (oxygenases)    1.13.11  With incorporation of two atoms of oxygen     1.13.11.81  7,8-dihydroneopterin oxygenase      NMS_0822  4. Lyases   4.1  Carbon-carbon lyases    4.1.2  Aldehyde-lyases     4.1.2.25  dihydroneopterin aldolase      NMS_0822  5. Isomerases   5.1  Racemases and epimerases    5.1.99  Acting on other compounds     5.1.99.8  7,8-dihydroneopterin epimerase      NMS_0822 BRITE hierarchy Motif Pfam:  FolB LptE Motif Other DBs NCBI-ProteinID:  BAO54831 UniProt:  W8VZM4 LinkDB All DBs Position complement(841434..841760) Genome browser AA seq 108 aa AA seqDB search MYTNHGCLDEEALIGSEYRVDLEVTTDLTKSSKTDDLKDTVDYVYLNKVIKEEMAIRSKL LEQVAQRILDRIFKEEEMVLEATVKVSKLNPPLGGDVEKVTIQMSQSR NT seq 327 nt NT seq  +upstreamnt  +downstreamnt gtgtataccaatcacggctgtctggatgaagaagctcttataggtagtgaatatcgtgtg gatctagaagtaacaaccgacttgaccaagagttccaaaacagatgatctaaaggatacc gtggactacgtttatttgaacaaggtgatcaaggaagaaatggctatacgttcaaaattg ttggaacaagtcgctcaacgtattctagatcgcatatttaaagaagaggaaatggtacta gaagctaccgtaaaggtttctaaactgaatccaccactgggcggtgacgttgaaaaagtg accattcaaatgtctcagtctagataa

DBGET integrated database retrieval system