Actinomadura parvosata subsp. kistnae: BKM31_10940 Help Entry BKM31_10940       CDS       T04759                                  Name (GenBank) MbtH family protein   KO K05375   MbtH protein Organism noa  Actinomadura parvosata subsp. kistnae Pathway noa00261   Monobactam biosynthesis noa01100   Metabolic pathways noa01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:noa00001]  09100 Metabolism   09110 Biosynthesis of other secondary metabolites    00261 Monobactam biosynthesis     BKM31_10940  09180 Brite Hierarchies   09181 Protein families: metabolism    01008 Polyketide biosynthesis proteins [BR:noa01008]     BKM31_10940 Polyketide biosynthesis proteins [BR:noa01008]  Nonribosomal peptide synthetase (NRPS)   Linear NRPS    Nocardicin synthetase     BKM31_10940 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  MbtH Motif Other DBs NCBI-ProteinID:  AQZ61918 UniProt:  A0A1U9ZVF1 LinkDB All DBs Position complement(2450211..2450426) Genome browser AA seq 71 aa AA seqDB search MTNPFDDPDGRFLVLVNAENQHSLWPAFAEVPGGWTVVLPESSRAACLDYIERHWTDLRP RSLAERADLGG NT seq 216 nt NT seq  +upstreamnt  +downstreamnt atgaccaaccccttcgacgacccggacggccgcttcctggtgctggtcaacgccgagaac cagcactcgttgtggcccgcgttcgccgaggtgcccggcggctggaccgtcgtcctgccg gagagcagccgggccgcgtgcctcgactacatcgagcgccactggaccgacctgcgcccg cgctcactggccgagcgggccgacctcggcgggtga

DBGET integrated database retrieval system