Nocardia otitidiscaviarum: FOH10_00695 Help Entry FOH10_00695       CDS       T06114                                  Name (GenBank) MbtH family protein   KO K05375   MbtH protein Organism nod  Nocardia otitidiscaviarum Pathway nod00261   Monobactam biosynthesis nod01100   Metabolic pathways nod01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:nod00001]  09100 Metabolism   09110 Biosynthesis of other secondary metabolites    00261 Monobactam biosynthesis     FOH10_00695  09180 Brite Hierarchies   09181 Protein families: metabolism    01008 Polyketide biosynthesis proteins [BR:nod01008]     FOH10_00695 Polyketide biosynthesis proteins [BR:nod01008]  Nonribosomal peptide synthetase (NRPS)   Linear NRPS    Nocardicin synthetase     FOH10_00695 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  MbtH Motif Other DBs NCBI-ProteinID:  QDP77475 UniProt:  A0A516NF03 LinkDB All DBs Position 171193..171408 Genome browser AA seq 71 aa AA seqDB search MSNPFDDADAQFYVLVNDEAQHSLWPVFAAIPGGWTIAHGPAERQNCLDFVESHWTDMRP LSLIEVMAENE NT seq 216 nt NT seq  +upstreamnt  +downstreamnt atgagcaatcccttcgacgacgcagacgcgcagttctatgtgctggtcaacgacgaggcg cagcattcgctgtggccggtgttcgccgccattccgggcggctggaccatcgcccacggt cccgccgaacggcagaactgtctggatttcgtcgagtcgcattggaccgatatgcgtccg ctctcgttgattgaggtcatggcggagaacgaatag

DBGET integrated database retrieval system