Nocardioides okcheonensis: LN652_02450 Help Entry LN652_02450       CDS       T07822                                  Name (GenBank) MbtH family protein   KO K05375   MbtH protein Organism noq  Nocardioides okcheonensis Pathway noq00261   Monobactam biosynthesis noq01100   Metabolic pathways noq01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:noq00001]  09100 Metabolism   09110 Biosynthesis of other secondary metabolites    00261 Monobactam biosynthesis     LN652_02450  09180 Brite Hierarchies   09181 Protein families: metabolism    01008 Polyketide biosynthesis proteins [BR:noq01008]     LN652_02450 Polyketide biosynthesis proteins [BR:noq01008]  Nonribosomal peptide synthetase (NRPS)   Linear NRPS    Nocardicin synthetase     LN652_02450 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  MbtH Motif Other DBs NCBI-ProteinID:  UFN45101 LinkDB All DBs Position 533300..533503 Genome browser AA seq 67 aa AA seqDB search MTNPFEDTDARYCVLVNAKGQHSLWPVFVAVPEGWQAELEDATRDDAMAWIEDNWDDPAT LGVAVGG NT seq 204 nt NT seq  +upstreamnt  +downstreamnt atgaccaacccgttcgaggacaccgacgcccgctactgcgtgctcgtcaacgccaaggga cagcactcgctgtggccggtcttcgtcgccgtgcccgagggctggcaggccgagctcgag gacgccacccgcgacgacgcgatggcgtggatcgaggacaactgggacgaccccgccacg ctgggggtcgcggtcggtggctga

DBGET integrated database retrieval system