Novosphingobium sp. EMRT-2: FA702_06810 Help Entry FA702_06810       CDS       T06038                                  Name (GenBank) chorismate mutase   KO K04092   chorismate mutase [EC:5.4.99.5] Organism nor  Novosphingobium sp. EMRT-2 Pathway nor00400   Phenylalanine, tyrosine and tryptophan biosynthesis nor01100   Metabolic pathways nor01110   Biosynthesis of secondary metabolites nor01230   Biosynthesis of amino acids Module nor_M00024   Phenylalanine biosynthesis, chorismate => phenylpyruvate => phenylalanine nor_M00040   Tyrosine biosynthesis, chorismate => arogenate => tyrosine Brite KEGG Orthology (KO) [BR:nor00001]  09100 Metabolism   09105 Amino acid metabolism    00400 Phenylalanine, tyrosine and tryptophan biosynthesis     FA702_06810 Enzymes [BR:nor01000]  5. Isomerases   5.4  Intramolecular transferases    5.4.99  Transferring other groups     5.4.99.5  chorismate mutase      FA702_06810 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  CM_2 Wbp11 Motif Other DBs NCBI-ProteinID:  QCI93292 UniProt:  A0A4D7DDF9 LinkDB All DBs Position 1393394..1393681 Genome browser AA seq 95 aa AA seqDB search MSDDPVLAGFRQSIDNIDAAMIHILAERFRITQAVGAYKAEKKLPASDPGREERQIARLR ALATDAKLDPEFSEKFLRFIIDEVIRHHEQAAAAG NT seq 288 nt NT seq  +upstreamnt  +downstreamnt atgagcgacgacccggtgctggcaggattccgccagagcatcgacaatatcgacgcggcg atgatccatattctcgccgaacggtttcgcatcacccaggcggtcggcgcgtacaaggcc gaaaagaagctgccggccagcgaccccggtcgcgaagaacgccagatcgcgcgtctgcgc gccctggcgaccgacgccaagctcgatcccgaattctcggaaaagttcctgcgcttcatc atcgacgaagtgatccgccaccatgagcaggcggccgcggcgggctga

DBGET integrated database retrieval system