Nostoc sp. PCC 7107: Nos7107_4835 Help Entry Nos7107_4835      CDS       T02362                                  Name (GenBank) dihydroneopterin aldolase   KO K01633   7,8-dihydroneopterin aldolase/epimerase/oxygenase [EC:4.1.2.25 5.1.99.8 1.13.11.81] Organism nos  Nostoc sp. PCC 7107 Pathway nos00790   Folate biosynthesis nos01100   Metabolic pathways nos01240   Biosynthesis of cofactors Brite KEGG Orthology (KO) [BR:nos00001]  09100 Metabolism   09108 Metabolism of cofactors and vitamins    00790 Folate biosynthesis     Nos7107_4835 Enzymes [BR:nos01000]  1. Oxidoreductases   1.13  Acting on single donors with incorporation of molecular oxygen (oxygenases)    1.13.11  With incorporation of two atoms of oxygen     1.13.11.81  7,8-dihydroneopterin oxygenase      Nos7107_4835  4. Lyases   4.1  Carbon-carbon lyases    4.1.2  Aldehyde-lyases     4.1.2.25  dihydroneopterin aldolase      Nos7107_4835  5. Isomerases   5.1  Racemases and epimerases    5.1.99  Acting on other compounds     5.1.99.8  7,8-dihydroneopterin epimerase      Nos7107_4835 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  FolB Motif Other DBs NCBI-ProteinID:  AFY45353 UniProt:  K9QJ15 LinkDB All DBs Position 5643971..5644336 Genome browser AA seq 121 aa AA seqDB search MDCIYLTGICCYGYTGYLPEEQVLGQWFEVDIKLWLDLSQAAETDAIADTLDYRSVISTI QNLVKTSRFALLEKLAGTIADTILQQSDRVTQVQVVVTKPAAPIPDFGGKISIELTRTGK R NT seq 366 nt NT seq  +upstreamnt  +downstreamnt atggactgtatttatttaacgggaatttgctgctatggctacacgggatatttaccagag gaacaagttttagggcaatggtttgaagtggatattaagctatggttagatttgtctcaa gctgcggaaactgatgcgatcgcagatactctcgattatcgcagtgtgattagcactatt caaaacttagtcaaaacatcccggttcgctttactcgaaaagttagcaggtacaattgcc gatactatcttgcaacagagcgatcgcgtcacgcaagtccaagttgtcgtcaccaaaccc gcagcgcctattcctgatttcggcggcaaaattagtattgaattgacgagaacagggaaa aggtga

DBGET integrated database retrieval system