Nocardia sp. CS682: DMB37_16905 Help Entry DMB37_16905       CDS       T06040                                  Name (GenBank) MbtH family protein   KO K05375   MbtH protein Organism noz  Nocardia sp. CS682 Pathway noz00261   Monobactam biosynthesis noz01100   Metabolic pathways noz01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:noz00001]  09100 Metabolism   09110 Biosynthesis of other secondary metabolites    00261 Monobactam biosynthesis     DMB37_16905  09180 Brite Hierarchies   09181 Protein families: metabolism    01008 Polyketide biosynthesis proteins [BR:noz01008]     DMB37_16905 Polyketide biosynthesis proteins [BR:noz01008]  Nonribosomal peptide synthetase (NRPS)   Linear NRPS    Nocardicin synthetase     DMB37_16905 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  MbtH Motif Other DBs NCBI-ProteinID:  QBS41557 UniProt:  A0A4P7H3U1 LinkDB All DBs Position complement(3769554..3769772) Genome browser AA seq 72 aa AA seqDB search MNNPFDDDGAQFYVLINDDGEHSLWPIFAAVPGGWTIAYGAAARKACLHYVETHWLDMRP KSLIEASANESS NT seq 219 nt NT seq  +upstreamnt  +downstreamnt atgaacaaccctttcgacgacgatggcgcccagttctacgtactgatcaacgacgacggc gagcactccctctggccgatcttcgcggccgttccgggcggctggaccatcgcctacggt gccgccgcccgtaaagcctgtctgcactacgtcgaaacacactggctcgatatgcgtccc aaatcactcatcgaggcctcggccaacgaaagttcctga

DBGET integrated database retrieval system