Nyctereutes procyonoides (raccoon dog): 129510730 Help Entry 129510730         CDS       T09008                                  Symbol IL1B Name (RefSeq) interleukin-1 beta   KO K04519   interleukin 1 beta Organism npo  Nyctereutes procyonoides (raccoon dog) Pathway npo01523   Antifolate resistance npo04010   MAPK signaling pathway npo04060   Cytokine-cytokine receptor interaction npo04064   NF-kappa B signaling pathway npo04217   Necroptosis npo04380   Osteoclast differentiation npo04620   Toll-like receptor signaling pathway npo04621   NOD-like receptor signaling pathway npo04623   Cytosolic DNA-sensing pathway npo04625   C-type lectin receptor signaling pathway npo04640   Hematopoietic cell lineage npo04657   IL-17 signaling pathway npo04659   Th17 cell differentiation npo04668   TNF signaling pathway npo04750   Inflammatory mediator regulation of TRP channels npo04932   Non-alcoholic fatty liver disease npo04933   AGE-RAGE signaling pathway in diabetic complications npo04936   Alcoholic liver disease npo04940   Type I diabetes mellitus npo05010   Alzheimer disease npo05020   Prion disease npo05022   Pathways of neurodegeneration - multiple diseases npo05132   Salmonella infection npo05133   Pertussis npo05134   Legionellosis npo05135   Yersinia infection npo05140   Leishmaniasis npo05142   Chagas disease npo05143   African trypanosomiasis npo05144   Malaria npo05146   Amoebiasis npo05152   Tuberculosis npo05162   Measles npo05163   Human cytomegalovirus infection npo05164   Influenza A npo05168   Herpes simplex virus 1 infection npo05171   Coronavirus disease - COVID-19 npo05321   Inflammatory bowel disease npo05323   Rheumatoid arthritis npo05332   Graft-versus-host disease npo05417   Lipid and atherosclerosis npo05418   Fluid shear stress and atherosclerosis Brite KEGG Orthology (KO) [BR:npo00001]  09130 Environmental Information Processing   09132 Signal transduction    04010 MAPK signaling pathway     129510730 (IL1B)    04064 NF-kappa B signaling pathway     129510730 (IL1B)    04668 TNF signaling pathway     129510730 (IL1B)   09133 Signaling molecules and interaction    04060 Cytokine-cytokine receptor interaction     129510730 (IL1B)  09140 Cellular Processes   09143 Cell growth and death    04217 Necroptosis     129510730 (IL1B)  09150 Organismal Systems   09151 Immune system    04640 Hematopoietic cell lineage     129510730 (IL1B)    04620 Toll-like receptor signaling pathway     129510730 (IL1B)    04621 NOD-like receptor signaling pathway     129510730 (IL1B)    04623 Cytosolic DNA-sensing pathway     129510730 (IL1B)    04625 C-type lectin receptor signaling pathway     129510730 (IL1B)    04659 Th17 cell differentiation     129510730 (IL1B)    04657 IL-17 signaling pathway     129510730 (IL1B)   09157 Sensory system    04750 Inflammatory mediator regulation of TRP channels     129510730 (IL1B)   09158 Development and regeneration    04380 Osteoclast differentiation     129510730 (IL1B)  09160 Human Diseases   09172 Infectious disease: viral    05171 Coronavirus disease - COVID-19     129510730 (IL1B)    05164 Influenza A     129510730 (IL1B)    05162 Measles     129510730 (IL1B)    05168 Herpes simplex virus 1 infection     129510730 (IL1B)    05163 Human cytomegalovirus infection     129510730 (IL1B)   09171 Infectious disease: bacterial    05132 Salmonella infection     129510730 (IL1B)    05135 Yersinia infection     129510730 (IL1B)    05133 Pertussis     129510730 (IL1B)    05134 Legionellosis     129510730 (IL1B)    05152 Tuberculosis     129510730 (IL1B)   09174 Infectious disease: parasitic    05146 Amoebiasis     129510730 (IL1B)    05144 Malaria     129510730 (IL1B)    05140 Leishmaniasis     129510730 (IL1B)    05142 Chagas disease     129510730 (IL1B)    05143 African trypanosomiasis     129510730 (IL1B)   09163 Immune disease    05323 Rheumatoid arthritis     129510730 (IL1B)    05321 Inflammatory bowel disease     129510730 (IL1B)    05332 Graft-versus-host disease     129510730 (IL1B)   09164 Neurodegenerative disease    05010 Alzheimer disease     129510730 (IL1B)    05020 Prion disease     129510730 (IL1B)    05022 Pathways of neurodegeneration - multiple diseases     129510730 (IL1B)   09166 Cardiovascular disease    05417 Lipid and atherosclerosis     129510730 (IL1B)    05418 Fluid shear stress and atherosclerosis     129510730 (IL1B)   09167 Endocrine and metabolic disease    04940 Type I diabetes mellitus     129510730 (IL1B)    04936 Alcoholic liver disease     129510730 (IL1B)    04932 Non-alcoholic fatty liver disease     129510730 (IL1B)    04933 AGE-RAGE signaling pathway in diabetic complications     129510730 (IL1B)   09176 Drug resistance: antineoplastic    01523 Antifolate resistance     129510730 (IL1B)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:npo04052]     129510730 (IL1B)    00536 Glycosaminoglycan binding proteins [BR:npo00536]     129510730 (IL1B) Cytokines and neuropeptides [BR:npo04052]  Cytokines   Interleukins    129510730 (IL1B) Glycosaminoglycan binding proteins [BR:npo00536]  Heparan sulfate / Heparin   Cytokines    129510730 (IL1B) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  IL1 IL1_propep CoV_Methyltr_2 Motif Other DBs NCBI-GeneID:  129510730 NCBI-ProteinID:  XP_055182902 LinkDB All DBs Position Unknown AA seq 265 aa AA seqDB search MAAVPELTSEMMAYSSNNENDLFFEADGPGKVKCCCQDLNHSSLVDEGIQLQVSHQLCNK SLRHFVSVIVALEKLKKPCPQVLQEDDLKSIFCYIFEEEPIICKTDADNFMSDAALQSVD CKLQDINHKYLVLSNSYELRALHLNGENVNKQVVFHMSFVHGDESNNKIPVVLGIKQKNL YLSCVMKDGKPTLQLETVDPKVYPKRKMEKRFVFNKIEIKNTVEFESSQYPNWYISTSQV EGMPVFLGNTKGGQDITDFIMEFSS NT seq 798 nt NT seq  +upstreamnt  +downstreamnt atggcagcagtacccgaactcaccagtgaaatgatggcttactccagtaacaatgagaat gacctattctttgaagctgatggccctggaaaggtgaagtgctgctgccaagacctgaac cacagttctctggtagatgagggcatccagttgcaagtctcccaccagctctgtaacaag agtctgaggcatttcgtgtcagtcattgtagctttggagaaactgaagaagccctgccca caggtcctccaggaggatgacctgaagagcatcttttgctacatctttgaagaagaacct atcatctgcaaaacagatgcggataattttatgagtgatgcagccctgcaatcggtggac tgcaagttacaggacataaaccacaaatacctggtgctgtctaactcatatgagcttcgg gctctccacctcaatggggaaaatgtgaacaaacaagtggtgttccacatgagctttgtg cacggggatgaaagtaataacaagatacctgtggtcttgggcatcaaacaaaagaatctg tacctgtcctgtgtgatgaaggatgggaagcccaccctacagctagagacggtagacccc aaagtctacccaaagaggaagatggaaaagcgatttgtcttcaacaagatagaaatcaag aacacagtggaatttgagtcttctcagtaccctaactggtacatcagcacctctcaagtc gaaggaatgcctgtcttcctaggaaataccaaaggtggccaggatataactgacttcatc atggaattctcttcctag

DBGET integrated database retrieval system