Nanorana parkeri (Xizang Plateau frog): 108801189 Help Entry 108801189         CDS       T04897                                  Name (RefSeq) ferritin, middle subunit-like   KO K00522   ferritin heavy chain [EC:1.16.3.1] Organism npr  Nanorana parkeri (Xizang Plateau frog) Pathway npr00860   Porphyrin metabolism npr04216   Ferroptosis npr04217   Necroptosis Brite KEGG Orthology (KO) [BR:npr00001]  09100 Metabolism   09108 Metabolism of cofactors and vitamins    00860 Porphyrin metabolism     108801189  09140 Cellular Processes   09143 Cell growth and death    04216 Ferroptosis     108801189    04217 Necroptosis     108801189  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:npr04147]     108801189 Enzymes [BR:npr01000]  1. Oxidoreductases   1.16  Oxidizing metal ions    1.16.3  With oxygen as acceptor     1.16.3.1  ferroxidase      108801189 Exosome [BR:npr04147]  Exosomal proteins   Exosomal proteins of other body fluids (saliva and urine)    108801189   Exosomal proteins of bladder cancer cells    108801189 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Ferritin YppF Motif Other DBs NCBI-GeneID:  108801189 NCBI-ProteinID:  XP_018428621 LinkDB All DBs Position Unknown AA seq 102 aa AA seqDB search MPIFVFFPQKPERDEWGNTLDAMQAALQLEKTVNHALLDLHKLATDKVDPHLCDFLESQY LEEQVKDIKRFGDYITNLKRLGVPQNGMGEYLFDKHSLEESS NT seq 309 nt NT seq  +upstreamnt  +downstreamnt atgcctatatttgttttttttcctcagaaaccagagcgtgatgagtggggtaacaccctg gatgccatgcaggctgctttgcagctggagaagactgtgaaccatgctcttctggacctg cacaagctagccactgacaaagttgaccctcatctgtgtgacttcttggaatctcaatat ctggaggaacaagtgaaggatattaagcgttttggagattacatcaccaacctgaagcgc cttggggtgccccagaatggcatgggcgagtacctgtttgacaagcatagcctggaagag agcagctaa

DBGET integrated database retrieval system