Nocardia mangyaensis: BOX37_02510 Help Entry BOX37_02510       CDS       T04582                                  Name (GenBank) MbtH family protein   KO K05375   MbtH protein Organism nsl  Nocardia mangyaensis Pathway nsl00261   Monobactam biosynthesis nsl01100   Metabolic pathways nsl01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:nsl00001]  09100 Metabolism   09110 Biosynthesis of other secondary metabolites    00261 Monobactam biosynthesis     BOX37_02510  09180 Brite Hierarchies   09181 Protein families: metabolism    01008 Polyketide biosynthesis proteins [BR:nsl01008]     BOX37_02510 Polyketide biosynthesis proteins [BR:nsl01008]  Nonribosomal peptide synthetase (NRPS)   Linear NRPS    Nocardicin synthetase     BOX37_02510 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  MbtH Motif Other DBs NCBI-ProteinID:  APE33029 UniProt:  A0A1J0VLZ1 LinkDB All DBs Position 548621..548857 Genome browser AA seq 78 aa AA seqDB search MSTNPFDDEDGRFFVLVNDEEQHSLWPAFAEVPAGWRVVFGEESRAACVEYVEKNWTDMR PKSLRDAMAADDAARAQS NT seq 237 nt NT seq  +upstreamnt  +downstreamnt atgagcaccaaccccttcgacgacgaggacggccgcttcttcgttctggtcaacgatgaa gagcagcactccctgtggcccgcattcgcggaggtcccggcgggttggcgtgtcgtgttc ggcgaagagagccgggccgcgtgcgtcgagtacgtcgagaagaactggaccgatatgcga cccaagagcctgcgcgacgcgatggccgccgacgatgcggcccgcgcccagtcctga

DBGET integrated database retrieval system