Nocardia sputorum: IFM12276_04510 Help Entry IFM12276_04510    CDS       T09151                                  Name (GenBank) protein mbtH   KO K05375   MbtH protein Organism nspu  Nocardia sputorum Pathway nspu00261   Monobactam biosynthesis nspu01100   Metabolic pathways nspu01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:nspu00001]  09100 Metabolism   09110 Biosynthesis of other secondary metabolites    00261 Monobactam biosynthesis     IFM12276_04510  09180 Brite Hierarchies   09181 Protein families: metabolism    01008 Polyketide biosynthesis proteins [BR:nspu01008]     IFM12276_04510 Polyketide biosynthesis proteins [BR:nspu01008]  Nonribosomal peptide synthetase (NRPS)   Linear NRPS    Nocardicin synthetase     IFM12276_04510 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  MbtH Motif Other DBs NCBI-ProteinID:  BDT97422 LinkDB All DBs Position 505653..505871 Genome browser AA seq 72 aa AA seqDB search MTNPFDNDDAKFYVLINQEGEHSLWPVFAAVPGGWTIAYGAANRKSCLEYVETHWVDMRP KSLIEAMSGETK NT seq 219 nt NT seq  +upstreamnt  +downstreamnt atgaccaacccgttcgacaacgacgacgccaagttctacgtcttgatcaaccaggagggc gagcactccttatggccggtcttcgccgccgtccccggcggctggaccatcgcctacggg gccgccaaccgcaagtcctgcctggagtacgtggagacccactgggtggacatgcgcccc aagtcgctcatcgaagccatgtccggcgaaacgaagtga

DBGET integrated database retrieval system