Nocardia tengchongensis: KHQ06_09845 Help Entry KHQ06_09845       CDS       T07484                                  Name (GenBank) MbtH family protein   KO K05375   MbtH protein Organism ntc  Nocardia tengchongensis Pathway ntc00261   Monobactam biosynthesis ntc01100   Metabolic pathways ntc01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:ntc00001]  09100 Metabolism   09110 Biosynthesis of other secondary metabolites    00261 Monobactam biosynthesis     KHQ06_09845  09180 Brite Hierarchies   09181 Protein families: metabolism    01008 Polyketide biosynthesis proteins [BR:ntc01008]     KHQ06_09845 Polyketide biosynthesis proteins [BR:ntc01008]  Nonribosomal peptide synthetase (NRPS)   Linear NRPS    Nocardicin synthetase     KHQ06_09845 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  MbtH Motif Other DBs NCBI-ProteinID:  QVI23178 LinkDB All DBs Position 2149676..2149894 Genome browser AA seq 72 aa AA seqDB search MSNPFDDENAQFYVLVNEEAQHSLWPVFAAIPGGWTAAHGPALRQSCLDYVEAHWTDMRP ASLVQAMSVEPE NT seq 219 nt NT seq  +upstreamnt  +downstreamnt atgagcaatccgttcgacgacgagaacgcccagttctacgtgctcgtcaacgaggaggcc cagcactcgctgtggccggtgttcgccgccatccccggcggctggaccgccgcgcacggc ccggctctgcgacagagctgcctggactacgtcgaggcgcactggaccgacatgcgaccg gcatcgctggtccaggccatgtcggtcgagcccgaatag

DBGET integrated database retrieval system