Nocardia terpenica: CRH09_03620 Help Entry CRH09_03620       CDS       T05168                                  Name (GenBank) MbtH family protein   KO K05375   MbtH protein Organism ntp  Nocardia terpenica Pathway ntp00261   Monobactam biosynthesis ntp01100   Metabolic pathways ntp01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:ntp00001]  09100 Metabolism   09110 Biosynthesis of other secondary metabolites    00261 Monobactam biosynthesis     CRH09_03620  09180 Brite Hierarchies   09181 Protein families: metabolism    01008 Polyketide biosynthesis proteins [BR:ntp01008]     CRH09_03620 Polyketide biosynthesis proteins [BR:ntp01008]  Nonribosomal peptide synthetase (NRPS)   Linear NRPS    Nocardicin synthetase     CRH09_03620 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  MbtH Motif Other DBs NCBI-ProteinID:  ATL65436 UniProt:  A0A164HU09 LinkDB All DBs Position 760943..761185 Genome browser AA seq 80 aa AA seqDB search MSTNPFDDEDGRFFVLVNDEEQHSLWPAFAEVPAGWRVVFGEDSRAACVEYVEKNWTDMR PKSLRDAMAADDAARQAAQS NT seq 243 nt NT seq  +upstreamnt  +downstreamnt atgagcaccaaccccttcgacgacgaggacggccgcttcttcgtcctggtcaacgacgag gaacagcattcgctgtggcccgccttcgccgaggttccggccggatggcgagtcgtcttc ggcgaggacagccgcgccgcctgcgtcgaatacgtcgagaagaactggaccgacatgcgg cccaagagcctgcgcgacgcgatggccgccgacgacgcggcccggcaggccgcccagtcc tga

DBGET integrated database retrieval system