Nocardia terpenica: CRH09_11865 Help Entry CRH09_11865       CDS       T05168                                  Name (GenBank) MbtH family protein   KO K05375   MbtH protein Organism ntp  Nocardia terpenica Pathway ntp00261   Monobactam biosynthesis ntp01100   Metabolic pathways ntp01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:ntp00001]  09100 Metabolism   09110 Biosynthesis of other secondary metabolites    00261 Monobactam biosynthesis     CRH09_11865  09180 Brite Hierarchies   09181 Protein families: metabolism    01008 Polyketide biosynthesis proteins [BR:ntp01008]     CRH09_11865 Polyketide biosynthesis proteins [BR:ntp01008]  Nonribosomal peptide synthetase (NRPS)   Linear NRPS    Nocardicin synthetase     CRH09_11865 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  MbtH Motif Other DBs NCBI-ProteinID:  ATL66801 UniProt:  A0A291RGS7 LinkDB All DBs Position 2651528..2651728 Genome browser AA seq 66 aa AA seqDB search MIGFDEYLVVRNDEEQYSVWPSARPVPDGWTATGVRGGRDECLAHIDEVWTDIRPKSVRD RLGSAD NT seq 201 nt NT seq  +upstreamnt  +downstreamnt atgatcggtttcgacgaatatctggttgtccggaacgacgaggagcagtattccgtgtgg ccgagcgcgcggccggtgccggacggctggacggcgaccggtgtgcggggcgggcgcgac gaatgcctggcgcatatcgacgaggtgtggaccgatatccggcccaagagtgtgcgtgac cgtctcggatccgccgactga

DBGET integrated database retrieval system