Nocardia terpenica: CRH09_29995 Help Entry CRH09_29995       CDS       T05168                                  Name (GenBank) MbtH family protein   KO K05375   MbtH protein Organism ntp  Nocardia terpenica Pathway ntp00261   Monobactam biosynthesis ntp01100   Metabolic pathways ntp01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:ntp00001]  09100 Metabolism   09110 Biosynthesis of other secondary metabolites    00261 Monobactam biosynthesis     CRH09_29995  09180 Brite Hierarchies   09181 Protein families: metabolism    01008 Polyketide biosynthesis proteins [BR:ntp01008]     CRH09_29995 Polyketide biosynthesis proteins [BR:ntp01008]  Nonribosomal peptide synthetase (NRPS)   Linear NRPS    Nocardicin synthetase     CRH09_29995 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  MbtH Emfourin Motif Other DBs NCBI-ProteinID:  ATL69776 UniProt:  A0A291RQF5 LinkDB All DBs Position complement(6761848..6762066) Genome browser AA seq 72 aa AA seqDB search MADNQQDDRTYRVVVNDEEQYSIWVTDRELPAGWHAEGTEGSRQECLDHIDEVWVDMRPL SLRRRMEQNTVG NT seq 219 nt NT seq  +upstreamnt  +downstreamnt atggctgacaatcagcaggacgatcgtacctaccgtgtggttgtcaacgacgaggagcag tactcgatttgggttaccgatcgtgagctgcctgccggttggcatgccgagggtacggaa gggtccaggcaggaatgcctcgatcatatcgatgaggtctgggtcgacatgcgtccgctg agcctgcgccgtcgcatggagcagaacaccgtcggctga

DBGET integrated database retrieval system