Nocardia wallacei: NWFMUON74_31120 Help Entry NWFMUON74_31120   CDS       T07034                                  Name (GenBank) protein mbtH   KO K05375   MbtH protein Organism nwl  Nocardia wallacei Pathway nwl00261   Monobactam biosynthesis nwl01100   Metabolic pathways nwl01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:nwl00001]  09100 Metabolism   09110 Biosynthesis of other secondary metabolites    00261 Monobactam biosynthesis     NWFMUON74_31120  09180 Brite Hierarchies   09181 Protein families: metabolism    01008 Polyketide biosynthesis proteins [BR:nwl01008]     NWFMUON74_31120 Polyketide biosynthesis proteins [BR:nwl01008]  Nonribosomal peptide synthetase (NRPS)   Linear NRPS    Nocardicin synthetase     NWFMUON74_31120 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  MbtH Motif Other DBs NCBI-ProteinID:  BCK55340 UniProt:  A0A7G1KJU6 LinkDB All DBs Position 3443312..3443509 Genome browser AA seq 65 aa AA seqDB search MTNPFDDDEAVFSVLVNDQGQHSLWPEFAEVPAGWTVVFGVAARQDCIDYIEQHWTDMRP ASIRG NT seq 198 nt NT seq  +upstreamnt  +downstreamnt atgaccaatcctttcgacgacgacgaggccgtcttctcggttctggtgaatgaccaaggg cagcactcgctctggccggaattcgccgaagttcccgcgggctggaccgtggtgttcggt gtcgcggcacgtcaggactgtatcgactatatcgagcagcactggaccgacatgcgtccg gcttcgattcgcggctga

DBGET integrated database retrieval system