Nocardia yunnanensis: D7D52_07065 Help Entry D7D52_07065       CDS       T09774                                  Name (GenBank) MbtH family protein   KO K05375   MbtH protein Organism nyu  Nocardia yunnanensis Pathway nyu00261   Monobactam biosynthesis nyu01100   Metabolic pathways nyu01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:nyu00001]  09100 Metabolism   09110 Biosynthesis of other secondary metabolites    00261 Monobactam biosynthesis     D7D52_07065  09180 Brite Hierarchies   09181 Protein families: metabolism    01008 Polyketide biosynthesis proteins [BR:nyu01008]     D7D52_07065 Polyketide biosynthesis proteins [BR:nyu01008]  Nonribosomal peptide synthetase (NRPS)   Linear NRPS    Nocardicin synthetase     D7D52_07065 BRITE hierarchy Motif Pfam:  MbtH Motif Other DBs NCBI-ProteinID:  AYF73657 UniProt:  A0A386Z8Y3 LinkDB All DBs Position 1510418..1510636 Genome browser AA seq 72 aa AA seqDB search MSNPFDDENAQFYVLVNEEAQHSLWPVFAAIPGGWNVAHGPALRQSCLDYVEAHWTDMRP ASLVQAMAVEPE NT seq 219 nt NT seq  +upstreamnt  +downstreamnt atgagcaatccgttcgacgacgaaaacgcccagttctacgtgctcgtcaacgaggaggcc cagcattcgctgtggccggtgttcgccgccatccccggcggctggaacgtcgcccacggg ccggcgctgcgccagagctgcctggactacgtcgaggcccactggaccgatatgcgaccg gcctcgctggtccaagccatggcggtagagcccgagtag

DBGET integrated database retrieval system