KEGG   Ovis aries (sheep): 101114005
Entry
101114005         CDS       T03117                                 
Symbol
KRAS
Name
(RefSeq) GTPase KRas isoform X1
  KO
K07827  GTPase KRas
Organism
oas  Ovis aries (sheep)
Pathway
oas01521  EGFR tyrosine kinase inhibitor resistance
oas01522  Endocrine resistance
oas04010  MAPK signaling pathway
oas04012  ErbB signaling pathway
oas04014  Ras signaling pathway
oas04015  Rap1 signaling pathway
oas04062  Chemokine signaling pathway
oas04068  FoxO signaling pathway
oas04071  Sphingolipid signaling pathway
oas04072  Phospholipase D signaling pathway
oas04137  Mitophagy - animal
oas04140  Autophagy - animal
oas04150  mTOR signaling pathway
oas04151  PI3K-Akt signaling pathway
oas04210  Apoptosis
oas04211  Longevity regulating pathway
oas04213  Longevity regulating pathway - multiple species
oas04218  Cellular senescence
oas04360  Axon guidance
oas04370  VEGF signaling pathway
oas04371  Apelin signaling pathway
oas04540  Gap junction
oas04550  Signaling pathways regulating pluripotency of stem cells
oas04625  C-type lectin receptor signaling pathway
oas04650  Natural killer cell mediated cytotoxicity
oas04660  T cell receptor signaling pathway
oas04662  B cell receptor signaling pathway
oas04664  Fc epsilon RI signaling pathway
oas04714  Thermogenesis
oas04720  Long-term potentiation
oas04722  Neurotrophin signaling pathway
oas04725  Cholinergic synapse
oas04726  Serotonergic synapse
oas04730  Long-term depression
oas04810  Regulation of actin cytoskeleton
oas04910  Insulin signaling pathway
oas04912  GnRH signaling pathway
oas04914  Progesterone-mediated oocyte maturation
oas04915  Estrogen signaling pathway
oas04916  Melanogenesis
oas04917  Prolactin signaling pathway
oas04919  Thyroid hormone signaling pathway
oas04921  Oxytocin signaling pathway
oas04926  Relaxin signaling pathway
oas04929  GnRH secretion
oas04933  AGE-RAGE signaling pathway in diabetic complications
oas04935  Growth hormone synthesis, secretion and action
oas04960  Aldosterone-regulated sodium reabsorption
oas05010  Alzheimer disease
oas05022  Pathways of neurodegeneration - multiple diseases
oas05034  Alcoholism
oas05160  Hepatitis C
oas05161  Hepatitis B
oas05163  Human cytomegalovirus infection
oas05165  Human papillomavirus infection
oas05166  Human T-cell leukemia virus 1 infection
oas05167  Kaposi sarcoma-associated herpesvirus infection
oas05170  Human immunodeficiency virus 1 infection
oas05200  Pathways in cancer
oas05203  Viral carcinogenesis
oas05205  Proteoglycans in cancer
oas05206  MicroRNAs in cancer
oas05207  Chemical carcinogenesis - receptor activation
oas05208  Chemical carcinogenesis - reactive oxygen species
oas05210  Colorectal cancer
oas05211  Renal cell carcinoma
oas05212  Pancreatic cancer
oas05213  Endometrial cancer
oas05214  Glioma
oas05215  Prostate cancer
oas05216  Thyroid cancer
oas05218  Melanoma
oas05219  Bladder cancer
oas05220  Chronic myeloid leukemia
oas05221  Acute myeloid leukemia
oas05223  Non-small cell lung cancer
oas05224  Breast cancer
oas05225  Hepatocellular carcinoma
oas05226  Gastric cancer
oas05230  Central carbon metabolism in cancer
oas05231  Choline metabolism in cancer
oas05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
oas05417  Lipid and atherosclerosis
Brite
KEGG Orthology (KO) [BR:oas00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    101114005 (KRAS)
   04012 ErbB signaling pathway
    101114005 (KRAS)
   04014 Ras signaling pathway
    101114005 (KRAS)
   04015 Rap1 signaling pathway
    101114005 (KRAS)
   04370 VEGF signaling pathway
    101114005 (KRAS)
   04371 Apelin signaling pathway
    101114005 (KRAS)
   04068 FoxO signaling pathway
    101114005 (KRAS)
   04072 Phospholipase D signaling pathway
    101114005 (KRAS)
   04071 Sphingolipid signaling pathway
    101114005 (KRAS)
   04151 PI3K-Akt signaling pathway
    101114005 (KRAS)
   04150 mTOR signaling pathway
    101114005 (KRAS)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    101114005 (KRAS)
   04137 Mitophagy - animal
    101114005 (KRAS)
  09143 Cell growth and death
   04210 Apoptosis
    101114005 (KRAS)
   04218 Cellular senescence
    101114005 (KRAS)
  09144 Cellular community - eukaryotes
   04540 Gap junction
    101114005 (KRAS)
   04550 Signaling pathways regulating pluripotency of stem cells
    101114005 (KRAS)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    101114005 (KRAS)
 09150 Organismal Systems
  09151 Immune system
   04625 C-type lectin receptor signaling pathway
    101114005 (KRAS)
   04650 Natural killer cell mediated cytotoxicity
    101114005 (KRAS)
   04660 T cell receptor signaling pathway
    101114005 (KRAS)
   04662 B cell receptor signaling pathway
    101114005 (KRAS)
   04664 Fc epsilon RI signaling pathway
    101114005 (KRAS)
   04062 Chemokine signaling pathway
    101114005 (KRAS)
  09152 Endocrine system
   04910 Insulin signaling pathway
    101114005 (KRAS)
   04929 GnRH secretion
    101114005 (KRAS)
   04912 GnRH signaling pathway
    101114005 (KRAS)
   04915 Estrogen signaling pathway
    101114005 (KRAS)
   04914 Progesterone-mediated oocyte maturation
    101114005 (KRAS)
   04917 Prolactin signaling pathway
    101114005 (KRAS)
   04921 Oxytocin signaling pathway
    101114005 (KRAS)
   04926 Relaxin signaling pathway
    101114005 (KRAS)
   04935 Growth hormone synthesis, secretion and action
    101114005 (KRAS)
   04919 Thyroid hormone signaling pathway
    101114005 (KRAS)
   04916 Melanogenesis
    101114005 (KRAS)
  09155 Excretory system
   04960 Aldosterone-regulated sodium reabsorption
    101114005 (KRAS)
  09156 Nervous system
   04725 Cholinergic synapse
    101114005 (KRAS)
   04726 Serotonergic synapse
    101114005 (KRAS)
   04720 Long-term potentiation
    101114005 (KRAS)
   04730 Long-term depression
    101114005 (KRAS)
   04722 Neurotrophin signaling pathway
    101114005 (KRAS)
  09158 Development and regeneration
   04360 Axon guidance
    101114005 (KRAS)
  09149 Aging
   04211 Longevity regulating pathway
    101114005 (KRAS)
   04213 Longevity regulating pathway - multiple species
    101114005 (KRAS)
  09159 Environmental adaptation
   04714 Thermogenesis
    101114005 (KRAS)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    101114005 (KRAS)
   05206 MicroRNAs in cancer
    101114005 (KRAS)
   05205 Proteoglycans in cancer
    101114005 (KRAS)
   05207 Chemical carcinogenesis - receptor activation
    101114005 (KRAS)
   05208 Chemical carcinogenesis - reactive oxygen species
    101114005 (KRAS)
   05203 Viral carcinogenesis
    101114005 (KRAS)
   05230 Central carbon metabolism in cancer
    101114005 (KRAS)
   05231 Choline metabolism in cancer
    101114005 (KRAS)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    101114005 (KRAS)
  09162 Cancer: specific types
   05210 Colorectal cancer
    101114005 (KRAS)
   05212 Pancreatic cancer
    101114005 (KRAS)
   05225 Hepatocellular carcinoma
    101114005 (KRAS)
   05226 Gastric cancer
    101114005 (KRAS)
   05214 Glioma
    101114005 (KRAS)
   05216 Thyroid cancer
    101114005 (KRAS)
   05221 Acute myeloid leukemia
    101114005 (KRAS)
   05220 Chronic myeloid leukemia
    101114005 (KRAS)
   05218 Melanoma
    101114005 (KRAS)
   05211 Renal cell carcinoma
    101114005 (KRAS)
   05219 Bladder cancer
    101114005 (KRAS)
   05215 Prostate cancer
    101114005 (KRAS)
   05213 Endometrial cancer
    101114005 (KRAS)
   05224 Breast cancer
    101114005 (KRAS)
   05223 Non-small cell lung cancer
    101114005 (KRAS)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    101114005 (KRAS)
   05170 Human immunodeficiency virus 1 infection
    101114005 (KRAS)
   05161 Hepatitis B
    101114005 (KRAS)
   05160 Hepatitis C
    101114005 (KRAS)
   05163 Human cytomegalovirus infection
    101114005 (KRAS)
   05167 Kaposi sarcoma-associated herpesvirus infection
    101114005 (KRAS)
   05165 Human papillomavirus infection
    101114005 (KRAS)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    101114005 (KRAS)
   05022 Pathways of neurodegeneration - multiple diseases
    101114005 (KRAS)
  09165 Substance dependence
   05034 Alcoholism
    101114005 (KRAS)
  09166 Cardiovascular disease
   05417 Lipid and atherosclerosis
    101114005 (KRAS)
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    101114005 (KRAS)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    101114005 (KRAS)
   01522 Endocrine resistance
    101114005 (KRAS)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:oas04131]
    101114005 (KRAS)
  09183 Protein families: signaling and cellular processes
   04031 GTP-binding proteins [BR:oas04031]
    101114005 (KRAS)
Membrane trafficking [BR:oas04131]
 Endocytosis
  Macropinocytosis
   Ras GTPases
    101114005 (KRAS)
GTP-binding proteins [BR:oas04031]
 Small (monomeric) G-proteins
  Ras Family
   Ras [OT]
    101114005 (KRAS)
SSDB
Motif
Pfam: Ras Roc Arf GTP_EFTU MMR_HSR1 RsgA_GTPase ATP_bind_1 FeoB_N Septin
Other DBs
NCBI-GeneID: 101114005
NCBI-ProteinID: XP_014950382
EnsemblRapid: ENSOARG00020040754
UniProt: A0A6P7DY74
LinkDB
Position
3:190373839..190417870
AA seq 189 aa
MTEYKLVVVGAGGVGKSALTIQLIQNHFVDEYDPTIEDSYRKQVVIDGETCLLDILDTAG
QEEYSAMRDQYMRTGEGFLCVFAINNTKSFEDIHHYREQIKRVKDSEDVPMVLVGNKCDL
PSRTVDTKQAQDLARSYGIPFIETSAKTRQRVEDAFYTLVREIRQYRLKKISKEEKTPGC
VKIKKCIVM
NT seq 570 nt   +upstreamnt  +downstreamnt
atgactgaatataaacttgtggtagttggagctggtggcgtaggcaagagtgccttgacg
atacagctaattcagaatcactttgtggatgaatatgatcctacgatagaggattcctac
aggaaacaagtagtaattgatggagaaacctgtctcttggatattctcgacacagcaggt
caagaggaatacagtgcaatgagggaccagtacatgaggactggggagggctttctttgt
gtatttgccataaataatactaaatcatttgaagatattcaccattatagagaacaaata
aaaagagttaaagactctgaagatgtacctatggttctagtaggaaataaatgtgatttg
ccttctagaacagtagacacaaaacaggctcaggacttagcaagaagttatggaattcct
tttattgaaacatcagcaaagacaagacagagagtggaggatgctttttatacattggtg
agagagatccgacaatacagattgaaaaaaatcagcaaagaagaaaagactcctggctgt
gtgaaaattaaaaaatgcattgttatgtaa

DBGET integrated database retrieval system