Ochrobactrum sp. BTU1: KMS41_04870 Help Entry KMS41_04870       CDS       T09943                                  Symbol folB Name (GenBank) dihydroneopterin aldolase   KO K01633   7,8-dihydroneopterin aldolase/epimerase/oxygenase [EC:4.1.2.25 5.1.99.8 1.13.11.81] Organism occ  Ochrobactrum sp. BTU1 Pathway occ00790   Folate biosynthesis occ01100   Metabolic pathways occ01240   Biosynthesis of cofactors Module occ_M00126   Tetrahydrofolate biosynthesis, GTP => THF Brite KEGG Orthology (KO) [BR:occ00001]  09100 Metabolism   09108 Metabolism of cofactors and vitamins    00790 Folate biosynthesis     KMS41_04870 (folB) Enzymes [BR:occ01000]  1. Oxidoreductases   1.13  Acting on single donors with incorporation of molecular oxygen (oxygenases)    1.13.11  With incorporation of two atoms of oxygen     1.13.11.81  7,8-dihydroneopterin oxygenase      KMS41_04870 (folB)  4. Lyases   4.1  Carbon-carbon lyases    4.1.2  Aldehyde-lyases     4.1.2.25  dihydroneopterin aldolase      KMS41_04870 (folB)  5. Isomerases   5.1  Racemases and epimerases    5.1.99  Acting on other compounds     5.1.99.8  7,8-dihydroneopterin epimerase      KMS41_04870 (folB) BRITE hierarchy Motif Pfam:  FolB Motif Other DBs NCBI-ProteinID:  QWK78567 LinkDB All DBs Position 1:1016002..1016361 Genome browser AA seq 119 aa AA seqDB search MYTIRIMNCAFFAHHGVFDEEHKLGQRFYVDAILDVDPGDSLENDDIEGTVHYGIAFTVI QDIITGSQRYLIETLALDVGKALTARFPQIKRAEITIRKPNAPVPGVLDHVEVTVVYPR NT seq 360 nt NT seq  +upstreamnt  +downstreamnt gtgtacaccatccgcatcatgaactgcgcatttttcgcgcatcacggcgtctttgacgaa gaacataaacttggtcagcgtttctacgttgatgcgatcctggatgtcgatccgggtgac tcgcttgaaaatgacgacattgaaggcacggtccactacggcatcgccttcactgtcatt caggacatcatcacaggcagccagcgctatctcattgaaacattggcacttgatgtcggc aaggcactgactgcgcgtttcccgcagatcaaacgtgctgaaatcaccattcgcaagcct aacgcaccagttccaggcgtgcttgatcatgttgaagtaacggtggtttatccacgctga

DBGET integrated database retrieval system