Tepiditoga spiralis: OSSY52_01610 Help Entry OSSY52_01610      CDS       T06810                                  Name (GenBank) ferredoxin   KO K00176   2-oxoglutarate ferredoxin oxidoreductase subunit delta [EC:1.2.7.3] Organism ocy  Tepiditoga spiralis Pathway ocy00020   Citrate cycle (TCA cycle) ocy01100   Metabolic pathways ocy01110   Biosynthesis of secondary metabolites ocy01120   Microbial metabolism in diverse environments ocy01200   Carbon metabolism ocy01210   2-Oxocarboxylic acid metabolism Brite KEGG Orthology (KO) [BR:ocy00001]  09100 Metabolism   09101 Carbohydrate metabolism    00020 Citrate cycle (TCA cycle)     OSSY52_01610 Enzymes [BR:ocy01000]  1. Oxidoreductases   1.2  Acting on the aldehyde or oxo group of donors    1.2.7  With an iron-sulfur protein as acceptor     1.2.7.3  2-oxoglutarate synthase      OSSY52_01610 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Fer4 Fer4_6 Fer4_7 Fer4_21 Fer4_2 Fer4_10 Fer4_9 Fer4_16 Fer4_4 Fer4_8 Fer4_17 Fer4_3 Fer4_13 Fer4_15 Fer4_22 Motif Other DBs NCBI-ProteinID:  BBE30020 UniProt:  A0A7G1G1G9 LinkDB All DBs Position 172854..173069 Genome browser AA seq 71 aa AA seqDB search MPSVKKNFKVEINYEYCKKCGLCYWICPTKTIIAGEYGKPEVPDHAKCIGCLQCEKICPD FAINVIEDGEK NT seq 216 nt NT seq  +upstreamnt  +downstreamnt atgccatccgtgaaaaaaaatttcaaggtggaaataaactatgagtactgtaaaaaatgt ggattatgttactggatatgtcctacaaaaacaataattgcaggagaatatggaaaacct gaagttccagatcatgctaaatgtattggatgtttacaatgtgaaaaaatatgtcctgat tttgcaataaatgttattgaggatggtgaaaaataa

DBGET integrated database retrieval system