Tepiditoga spiralis: OSSY52_18630 Help Entry OSSY52_18630      CDS       T06810                                  Symbol folB Name (GenBank) 7,8-dihydroneopterin aldolase   KO K01633   7,8-dihydroneopterin aldolase/epimerase/oxygenase [EC:4.1.2.25 5.1.99.8 1.13.11.81] Organism ocy  Tepiditoga spiralis Pathway ocy00790   Folate biosynthesis ocy01100   Metabolic pathways ocy01240   Biosynthesis of cofactors Module ocy_M00126   Tetrahydrofolate biosynthesis, GTP => THF Brite KEGG Orthology (KO) [BR:ocy00001]  09100 Metabolism   09108 Metabolism of cofactors and vitamins    00790 Folate biosynthesis     OSSY52_18630 (folB) Enzymes [BR:ocy01000]  1. Oxidoreductases   1.13  Acting on single donors with incorporation of molecular oxygen (oxygenases)    1.13.11  With incorporation of two atoms of oxygen     1.13.11.81  7,8-dihydroneopterin oxygenase      OSSY52_18630 (folB)  4. Lyases   4.1  Carbon-carbon lyases    4.1.2  Aldehyde-lyases     4.1.2.25  dihydroneopterin aldolase      OSSY52_18630 (folB)  5. Isomerases   5.1  Racemases and epimerases    5.1.99  Acting on other compounds     5.1.99.8  7,8-dihydroneopterin epimerase      OSSY52_18630 (folB) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  FolB Motif Other DBs NCBI-ProteinID:  BBE31722 UniProt:  A0A7G1GBE6 LinkDB All DBs Position 2016608..2016982 Genome browser AA seq 124 aa AA seqDB search MDKIIMKNLGFYGYHGVLKEENKLGQKFFIDVEMYLNLEKAGKTDDVNDTISYAETYKVV KKIVENENHNLLEKIAQRICNELFKDFEKIDEIKVKIRKPEAPVHGIYDYFGIEIRRKRN EIIS NT seq 375 nt NT seq  +upstreamnt  +downstreamnt atggataaaataataatgaaaaatttaggtttttatggttaccatggtgttttaaaagaa gaaaataaattaggtcaaaaattctttatagatgttgaaatgtatttaaacttagaaaaa gcgggaaaaacagatgatgttaatgatactatttcttacgccgaaacatataaagttgta aaaaaaatagtagaaaatgaaaaccacaatttattagaaaaaatagctcaaagaatatgc aatgaactatttaaagactttgaaaaaatagatgaaataaaagtaaaaataagaaaacca gaagcacccgtacatggaatatatgattactttggcatagaaataaggagaaaaagaaat gaaatcatatcttag

DBGET integrated database retrieval system