Oncorhynchus gorbuscha (pink salmon): 123999748 Help Entry 123999748         CDS       T07892                                  Name (RefSeq) ferritin, middle subunit-like   KO K00522   ferritin heavy chain [EC:1.16.3.1] Organism ogo  Oncorhynchus gorbuscha (pink salmon) Pathway ogo00860   Porphyrin metabolism ogo04216   Ferroptosis ogo04217   Necroptosis Brite KEGG Orthology (KO) [BR:ogo00001]  09100 Metabolism   09108 Metabolism of cofactors and vitamins    00860 Porphyrin metabolism     123999748  09140 Cellular Processes   09143 Cell growth and death    04216 Ferroptosis     123999748    04217 Necroptosis     123999748  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:ogo04147]     123999748 Enzymes [BR:ogo01000]  1. Oxidoreductases   1.16  Oxidizing metal ions    1.16.3  With oxygen as acceptor     1.16.3.1  ferroxidase      123999748 Exosome [BR:ogo04147]  Exosomal proteins   Exosomal proteins of other body fluids (saliva and urine)    123999748   Exosomal proteins of bladder cancer cells    123999748 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Ferritin AlphaC_N Motif Other DBs NCBI-GeneID:  123999748 NCBI-ProteinID:  XP_046161734 LinkDB All DBs Position LG16:33470716..33472455 Genome browser AA seq 108 aa AA seqDB search MPNKRGGRILLQDIKKPERDEWGNGLEAMQCALQLEKNVNQALLDLHKIASDKVDPHLCD FLETHYLNEQVEAIKKLGDYITNLTKMDAVKNKMAEYLFDKHTLGGQS NT seq 327 nt NT seq  +upstreamnt  +downstreamnt atgccaaacaagcgaggtggacgcattttactccaggacatcaagaagccagaacgtgat gagtggggcaatgggctggaggcaatgcagtgtgctctgcagctggagaagaatgtgaac caggccctgctggacctgcacaagattgcctctgacaaggttgacccccatctgtgtgac ttcctggagacccattacctgaatgagcaggtggaggccattaagaagctgggagactac atcaccaacctcaccaagatggatgctgtcaaaaacaagatggcagagtacctgtttgac aagcacaccctgggaggccagagctaa

DBGET integrated database retrieval system