Oncorhynchus gorbuscha (pink salmon): 124026883 Help Entry 124026883         CDS       T07892                                  Name (RefSeq) ferritin, middle subunit-like   KO K00522   ferritin heavy chain [EC:1.16.3.1] Organism ogo  Oncorhynchus gorbuscha (pink salmon) Pathway ogo00860   Porphyrin metabolism ogo04216   Ferroptosis ogo04217   Necroptosis Brite KEGG Orthology (KO) [BR:ogo00001]  09100 Metabolism   09108 Metabolism of cofactors and vitamins    00860 Porphyrin metabolism     124026883  09140 Cellular Processes   09143 Cell growth and death    04216 Ferroptosis     124026883    04217 Necroptosis     124026883  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:ogo04147]     124026883 Enzymes [BR:ogo01000]  1. Oxidoreductases   1.16  Oxidizing metal ions    1.16.3  With oxygen as acceptor     1.16.3.1  ferroxidase      124026883 Exosome [BR:ogo04147]  Exosomal proteins   Exosomal proteins of other body fluids (saliva and urine)    124026883   Exosomal proteins of bladder cancer cells    124026883 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Ferritin Rubrerythrin Motif Other DBs NCBI-GeneID:  124026883 NCBI-ProteinID:  XP_046195508 LinkDB All DBs Position Unknown AA seq 139 aa AA seqDB search MESQIRQNYHHDCEAAINRMINLEMFASYTYTSMAFYFSRDDVALRGFAHFFKENSDEER EHADKLLSFQNKRGGRILLQDIKKPERDEWGNGLEAMQCALQLEKNVNHALLDLHKIASD KVDPHMHTMQLMRKGQQFV NT seq 420 nt NT seq  +upstreamnt  +downstreamnt atggagtctcagatccgccagaactatcaccacgattgcgaagctgccatcaaccggatg atcaacttggagatgtttgcctcctacacctacacttcaatggctttctatttctcccgt gacgatgtggctctgcgtggcttcgcgcatttcttcaaggagaacagcgacgaggagcgg gagcacgccgacaagctactctccttccagaacaagagaggtggacgcattttactccag gacatcaagaagccagaacgtgatgagtggggcaatgggctggaggccatgcagtgtgct ctgcagctggagaagaatgtgaaccatgccctgctggacctgcacaagattgcctctgac aaggttgacccccatatgcacacaatgcagctaatgcgtaaggggcagcagtttgtctag

DBGET integrated database retrieval system