Oncorhynchus keta (chum salmon): 118380441 Help Entry 118380441         CDS       T09424                                  Name (RefSeq) ferritin, middle subunit-like   KO K00522   ferritin heavy chain [EC:1.16.3.1] Organism oke  Oncorhynchus keta (chum salmon) Pathway oke00860   Porphyrin metabolism oke04216   Ferroptosis oke04217   Necroptosis Brite KEGG Orthology (KO) [BR:oke00001]  09100 Metabolism   09108 Metabolism of cofactors and vitamins    00860 Porphyrin metabolism     118380441  09140 Cellular Processes   09143 Cell growth and death    04216 Ferroptosis     118380441    04217 Necroptosis     118380441  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:oke04147]     118380441 Enzymes [BR:oke01000]  1. Oxidoreductases   1.16  Oxidizing metal ions    1.16.3  With oxygen as acceptor     1.16.3.1  ferroxidase      118380441 Exosome [BR:oke04147]  Exosomal proteins   Exosomal proteins of other body fluids (saliva and urine)    118380441   Exosomal proteins of bladder cancer cells    118380441 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Ferritin Rubrerythrin Motif Other DBs NCBI-GeneID:  118380441 NCBI-ProteinID:  XP_035623320 LinkDB All DBs Position Unknown AA seq 132 aa AA seqDB search MESQIRQNYHHDCEAAINRMINLEMFASYTYTSMAFYFSRDDVALPGFAHFFKENSDEER EHADKLLSFQNKRGGRILLQDIKKPERDEWGNGLEAMQCALQLEKNVNQALLDLHKIASD KVDPHLCDFLET NT seq 396 nt NT seq  +upstreamnt  +downstreamnt atggagtctcagatccgccagaactatcaccacgattgcgaagctgctatcaaccggatg atcaacttggagatgtttgcctcctacacctacacttcaatggctttctatttctcccgt gacgatgtggctctgcctggcttcgcgcatttcttcaaggagaacagcgacgaggagcga gagcacgccgacaagctactctccttccagaacaagagaggtggacgcattttactccag gacatcaagaagccagaacgtgatgagtggggcaatgggctggaggccatgcagtgtgct ctgcagctggagaagaatgtgaaccaggccctgctggacctgcacaagattgcctctgac aaggttgacccccatctgtgtgacttcctggagacc

DBGET integrated database retrieval system