Ostreococcus lucimarinus: OSTLU_8797 Help Entry OSTLU_8797        CDS       T01029                                  Name (RefSeq) predicted protein   KO K03014   DNA-directed RNA polymerases I, II, and III subunit RPABC2 Organism olu  Ostreococcus lucimarinus Pathway olu03020   RNA polymerase olu03420   Nucleotide excision repair Brite KEGG Orthology (KO) [BR:olu00001]  09120 Genetic Information Processing   09121 Transcription    03020 RNA polymerase     OSTLU_8797   09124 Replication and repair    03420 Nucleotide excision repair     OSTLU_8797  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03021 Transcription machinery [BR:olu03021]     OSTLU_8797    03400 DNA repair and recombination proteins [BR:olu03400]     OSTLU_8797 Transcription machinery [BR:olu03021]  Eukaryotic type   RNA polymerase II system    RNA polymerase II     Pol I, II, III common subunits      OSTLU_8797   RNA polymerase III system    RNA polymerase III      OSTLU_8797   RNA polymerase I system    RNA polymerase I      OSTLU_8797 DNA repair and recombination proteins [BR:olu03400]  Eukaryotic type   SSBR (single strand breaks repair)    NER (nucleotide excision repair)     TCR (transcription coupled repair) factors      DNA-directed RNA polymerase II complex       OSTLU_8797 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  RNA_pol_Rpb6 Motif Other DBs NCBI-GeneID:  5000420 NCBI-ProteinID:  XP_001416481 JGI:  8797 UniProt:  A4RSJ5 LinkDB All DBs Position 2:complement(<748499..>748741) Genome browser AA seq 81 aa AA seqDB search AVPRHERTTTPYMTKYERARILGTRALQISMNAPVLVQLEGETDPLEIAGKELREKRVPF VVRRYMPDGSYEDWGIDELIV NT seq 243 nt NT seq  +upstreamnt  +downstreamnt gcggtgccgaggcacgagcggacgacgacgccgtacatgacaaagtacgagcgggcgcgc atcctggggacgagggcgctgcagatttcgatgaacgcgccggtgttggtgcagctcgag ggagagacggatccgctggagatcgccgggaaggagttgagggagaaaagagtgccgttt gtggtgcggcggtacatgccggacgggagttacgaggattgggggatcgacgagttgatc gtg

DBGET integrated database retrieval system