Onychostoma macrolepis: 131536821 Help Entry 131536821         CDS       T09350                                  Symbol zgc:55558 Name (RefSeq) GTPase KRas isoform X1   KO K07827   GTPase KRas Organism omc  Onychostoma macrolepis Pathway omc04010   MAPK signaling pathway omc04012   ErbB signaling pathway omc04068   FoxO signaling pathway omc04137   Mitophagy - animal omc04140   Autophagy - animal omc04150   mTOR signaling pathway omc04210   Apoptosis omc04218   Cellular senescence omc04370   VEGF signaling pathway omc04371   Apelin signaling pathway omc04540   Gap junction omc04625   C-type lectin receptor signaling pathway omc04810   Regulation of actin cytoskeleton omc04910   Insulin signaling pathway omc04912   GnRH signaling pathway omc04914   Progesterone-mediated oocyte maturation omc04916   Melanogenesis Brite KEGG Orthology (KO) [BR:omc00001]  09130 Environmental Information Processing   09132 Signal transduction    04010 MAPK signaling pathway     131536821 (zgc:55558)    04012 ErbB signaling pathway     131536821 (zgc:55558)    04370 VEGF signaling pathway     131536821 (zgc:55558)    04371 Apelin signaling pathway     131536821 (zgc:55558)    04068 FoxO signaling pathway     131536821 (zgc:55558)    04150 mTOR signaling pathway     131536821 (zgc:55558)  09140 Cellular Processes   09141 Transport and catabolism    04140 Autophagy - animal     131536821 (zgc:55558)    04137 Mitophagy - animal     131536821 (zgc:55558)   09143 Cell growth and death    04210 Apoptosis     131536821 (zgc:55558)    04218 Cellular senescence     131536821 (zgc:55558)   09144 Cellular community - eukaryotes    04540 Gap junction     131536821 (zgc:55558)   09142 Cell motility    04810 Regulation of actin cytoskeleton     131536821 (zgc:55558)  09150 Organismal Systems   09151 Immune system    04625 C-type lectin receptor signaling pathway     131536821 (zgc:55558)   09152 Endocrine system    04910 Insulin signaling pathway     131536821 (zgc:55558)    04912 GnRH signaling pathway     131536821 (zgc:55558)    04914 Progesterone-mediated oocyte maturation     131536821 (zgc:55558)    04916 Melanogenesis     131536821 (zgc:55558)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:omc04131]     131536821 (zgc:55558)   09183 Protein families: signaling and cellular processes    04031 GTP-binding proteins [BR:omc04031]     131536821 (zgc:55558) Membrane trafficking [BR:omc04131]  Endocytosis   Macropinocytosis    Ras GTPases     131536821 (zgc:55558) GTP-binding proteins [BR:omc04031]  Small (monomeric) G-proteins   Ras Family    Ras [OT]     131536821 (zgc:55558) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Ras Roc Arf GTP_EFTU RsgA_GTPase MMR_HSR1 FeoB_N ATP_bind_1 AAA_33 Septin AAA_22 AAA_14 POC3_POC4 Motif Other DBs NCBI-GeneID:  131536821 NCBI-ProteinID:  XP_058625943 LinkDB All DBs Position 03:complement(40271134..40277725) Genome browser AA seq 188 aa AA seqDB search MTEYKLVVVGAGGVGKSALTIQLIQNHFVDEYDPTIEQDSYRKQVVIDGETCLLDILDTA GQEEYSAMRDQYMRTGEGFLCVFAINNAKSFEDVHLYREQINRVKDSDNVPMVLVGNKSD LTSRTVETLQAQELARSYGVPYVETSAKTRQGVEDAFYSLVRVIRRYKETNRSNKKSKKH TQRRCILL NT seq 567 nt NT seq  +upstreamnt  +downstreamnt atgacagaatacaagctggtagttgtcggggctggtggcgttggcaaaagcgcactgacc atccagctcatacagaatcactttgtagacgagtatgaccccactattgagcaggattct tatagaaagcaagttgtgattgatggagagacgtgtttgctggacatcctagacaccgca ggtcaggaggagtacagtgccatgagagatcagtatatgaggacaggagagggctttctg tgtgtgtttgccatcaacaacgccaagtcctttgaggacgtacatctttacagggagcaa ataaaccgtgtcaaagacagcgacaatgtcccgatggtgctggtggggaacaaaagtgac ctgacctctcgtactgtagagacacttcaagcccaagagctcgccagaagttacggggtc ccatatgtcgaaacatctgccaagacgcgacagggtgttgaggacgcgttttactctctc gtgcgggtgatccgaagatacaaggagacgaaccgcagtaataagaagagcaaaaagcac acacagagacgctgcattcttttatag

DBGET integrated database retrieval system