Oryzias melastigma (Indian medaka): 112138554 Help Entry 112138554         CDS       T07439                                  Name (RefSeq) ferritin, middle subunit-like   KO K00522   ferritin heavy chain [EC:1.16.3.1] Organism oml  Oryzias melastigma (Indian medaka) Pathway oml00860   Porphyrin metabolism oml04216   Ferroptosis oml04217   Necroptosis Brite KEGG Orthology (KO) [BR:oml00001]  09100 Metabolism   09108 Metabolism of cofactors and vitamins    00860 Porphyrin metabolism     112138554  09140 Cellular Processes   09143 Cell growth and death    04216 Ferroptosis     112138554    04217 Necroptosis     112138554  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:oml04147]     112138554 Enzymes [BR:oml01000]  1. Oxidoreductases   1.16  Oxidizing metal ions    1.16.3  With oxygen as acceptor     1.16.3.1  ferroxidase      112138554 Exosome [BR:oml04147]  Exosomal proteins   Exosomal proteins of other body fluids (saliva and urine)    112138554   Exosomal proteins of bladder cancer cells    112138554 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Ferritin Motif Other DBs NCBI-GeneID:  112138554 NCBI-ProteinID:  XP_024116880 Ensembl:  ENSOMEG00000021756 LinkDB All DBs Position LG8:24698514..24699061 Genome browser AA seq 98 aa AA seqDB search MCAPQKPERDEWGSGLEAMQCALQLEKNVNQALLDLHKLASDHKDPHLCDFLESHYLNEQ VESIKKLGDHITNLTRMDAHTNKMAEYLFDKHTLGSKS NT seq 297 nt NT seq  +upstreamnt  +downstreamnt atgtgtgctccacagaaaccagagcgtgatgagtggggcagtgggctggaagccatgcag tgcgccctgcagctggagaagaacgtcaaccaggctctgctggacctgcacaagctggcc tctgaccacaaagaccctcatctgtgtgacttcctggagtctcactacctgaacgaacag gtggagtccatcaagaagcttggtgaccacatcaccaacctcacccgcatggatgctcac accaacaagatggcagagtatctgtttgacaagcacaccctgggcagcaagagctaa

DBGET integrated database retrieval system