Oryzias melastigma (Indian medaka): 112152425 Help Entry 112152425         CDS       T07439                                  Symbol kras Name (RefSeq) GTPase KRas isoform X1   KO K07827   GTPase KRas Organism oml  Oryzias melastigma (Indian medaka) Pathway oml04010   MAPK signaling pathway oml04012   ErbB signaling pathway oml04068   FoxO signaling pathway oml04137   Mitophagy - animal oml04140   Autophagy - animal oml04150   mTOR signaling pathway oml04210   Apoptosis oml04218   Cellular senescence oml04370   VEGF signaling pathway oml04371   Apelin signaling pathway oml04540   Gap junction oml04625   C-type lectin receptor signaling pathway oml04810   Regulation of actin cytoskeleton oml04910   Insulin signaling pathway oml04912   GnRH signaling pathway oml04914   Progesterone-mediated oocyte maturation oml04916   Melanogenesis Brite KEGG Orthology (KO) [BR:oml00001]  09130 Environmental Information Processing   09132 Signal transduction    04010 MAPK signaling pathway     112152425 (kras)    04012 ErbB signaling pathway     112152425 (kras)    04370 VEGF signaling pathway     112152425 (kras)    04371 Apelin signaling pathway     112152425 (kras)    04068 FoxO signaling pathway     112152425 (kras)    04150 mTOR signaling pathway     112152425 (kras)  09140 Cellular Processes   09141 Transport and catabolism    04140 Autophagy - animal     112152425 (kras)    04137 Mitophagy - animal     112152425 (kras)   09143 Cell growth and death    04210 Apoptosis     112152425 (kras)    04218 Cellular senescence     112152425 (kras)   09144 Cellular community - eukaryotes    04540 Gap junction     112152425 (kras)   09142 Cell motility    04810 Regulation of actin cytoskeleton     112152425 (kras)  09150 Organismal Systems   09151 Immune system    04625 C-type lectin receptor signaling pathway     112152425 (kras)   09152 Endocrine system    04910 Insulin signaling pathway     112152425 (kras)    04912 GnRH signaling pathway     112152425 (kras)    04914 Progesterone-mediated oocyte maturation     112152425 (kras)    04916 Melanogenesis     112152425 (kras)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:oml04131]     112152425 (kras)   09183 Protein families: signaling and cellular processes    04031 GTP-binding proteins [BR:oml04031]     112152425 (kras) Membrane trafficking [BR:oml04131]  Endocytosis   Macropinocytosis    Ras GTPases     112152425 (kras) GTP-binding proteins [BR:oml04031]  Small (monomeric) G-proteins   Ras Family    Ras [OT]     112152425 (kras) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Ras Roc Arf GTP_EFTU MMR_HSR1 RsgA_GTPase FeoB_N ATP_bind_1 Septin Ldh_1_N Motif Other DBs NCBI-GeneID:  112152425 NCBI-ProteinID:  XP_024137768 Ensembl:  ENSOMEG00000011273 LinkDB All DBs Position LG6:23378215..23387927 Genome browser AA seq 189 aa AA seqDB search MTEYKLVVVGAGGVGKSALTIQLIQNHFVDEYDPTIEDSYRKQVVIDGETCLLDILDTAG QEEYSAMRDQYMRTGEGFLCVFAINNTKSFEDIHHYREQIKRVKDSEDVPMVLVGNKCDL PTRTVDTKQAQDLARSFGIPFIETSAKTRQRVEDAFYTLVREIRQYRLSKLSKEEKTPRC VNLKKCVVM NT seq 570 nt NT seq  +upstreamnt  +downstreamnt atgacggaatataagctggttgtggtgggagctggtggcgttggcaagagcgcgctcacc atccagctcatccaaaaccattttgtggatgaatatgaccccaccattgaggactcttac agaaaacaggtagtaattgatggagagacgtgtctcctggacatcctggacactgcaggt caagaggagtacagcgccatgagggatcagtacatgaggacaggggaaggctttctctgt gtttttgctatcaataacaccaagtcctttgaagacattcaccattatagagaacagatt aagcgggtgaaggactctgaggacgtccccatggtgttggtgggaaacaagtgtgacctc cccacccggacggtggacaccaagcaggctcaggacttggcacgcagcttcggcattccc tttattgaaacctcagccaaaaccagacagagagtggaagatgccttttacactctggta cgggagatcaggcagtaccggctcagtaagctcagcaaggaagaaaagactccacgctgt gtcaaccttaaaaagtgtgttgtgatgtga

DBGET integrated database retrieval system