Oncorhynchus nerka (sockeye salmon): 115119931 Help Entry 115119931         CDS       T07952                                  Name (RefSeq) ferritin, middle subunit-like   KO K00522   ferritin heavy chain [EC:1.16.3.1] Organism one  Oncorhynchus nerka (sockeye salmon) Pathway one00860   Porphyrin metabolism one04216   Ferroptosis one04217   Necroptosis Brite KEGG Orthology (KO) [BR:one00001]  09100 Metabolism   09108 Metabolism of cofactors and vitamins    00860 Porphyrin metabolism     115119931  09140 Cellular Processes   09143 Cell growth and death    04216 Ferroptosis     115119931    04217 Necroptosis     115119931  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:one04147]     115119931 Enzymes [BR:one01000]  1. Oxidoreductases   1.16  Oxidizing metal ions    1.16.3  With oxygen as acceptor     1.16.3.1  ferroxidase      115119931 Exosome [BR:one04147]  Exosomal proteins   Exosomal proteins of other body fluids (saliva and urine)    115119931   Exosomal proteins of bladder cancer cells    115119931 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Ferritin Motif Other DBs NCBI-GeneID:  115119931 NCBI-ProteinID:  XP_029504686 LinkDB All DBs Position Unknown AA seq 93 aa AA seqDB search KPERDEWGNGLEAMQCALQLEKNVNQTLLDLHKIASDKVDPHLCDFLETHYLNEQVEAIK KLGDHITNLTKMDVVKNKMSEYLFDKHTLGGQS NT seq 282 nt NT seq  +upstreamnt  +downstreamnt aagccagaacgtgatgagtggggcaatgggctggaggccatgcagtgtgctctgcagctg gagaagaatgtgaaccagaccctgctggacctgcacaagattgcctctgacaaggttgac ccccatctgtgtgactttctggagacccattacctgaatgagcaggtggaggccattaag aagctgggtgaccacatcaccaacctcaccaagatggatgttgtcaaaaacaagatgtca gagtacctgtttgacaagcacaccctgggaggccagagctaa

DBGET integrated database retrieval system