Oncorhynchus nerka (sockeye salmon): 115121534 Help Entry 115121534         CDS       T07952                                  Name (RefSeq) ferritin, middle subunit-like   KO K00522   ferritin heavy chain [EC:1.16.3.1] Organism one  Oncorhynchus nerka (sockeye salmon) Pathway one00860   Porphyrin metabolism one04216   Ferroptosis one04217   Necroptosis Brite KEGG Orthology (KO) [BR:one00001]  09100 Metabolism   09108 Metabolism of cofactors and vitamins    00860 Porphyrin metabolism     115121534  09140 Cellular Processes   09143 Cell growth and death    04216 Ferroptosis     115121534    04217 Necroptosis     115121534  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:one04147]     115121534 Enzymes [BR:one01000]  1. Oxidoreductases   1.16  Oxidizing metal ions    1.16.3  With oxygen as acceptor     1.16.3.1  ferroxidase      115121534 Exosome [BR:one04147]  Exosomal proteins   Exosomal proteins of other body fluids (saliva and urine)    115121534   Exosomal proteins of bladder cancer cells    115121534 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Ferritin Rubrerythrin Motif Other DBs NCBI-GeneID:  115121534 NCBI-ProteinID:  XP_029506500 LinkDB All DBs Position Unknown AA seq 147 aa AA seqDB search MESQIRQNYHHDCEAAINRMINLEMFASYTYTSMAFYFSRDDVALPGFAHFFKENSDEER EHADKLLSFQNKRGGRILLQDIKKPERDEWGNGLEAMQCALQLEKNVNQALLDLHKIAFH KVDPHVSYGGTAHHMYVSHKYRYCPRR NT seq 444 nt NT seq  +upstreamnt  +downstreamnt atggagtctcagatccgccagaactatcaccacgattgcgaagctgccatcaaccggatg atcaacttggagatgtttgcctcctacacctacacctcaatggctttctatttctcccgt gacgatgtggctctgcctggctttgcgcatttcttcaaggagaacagcgacgaggagcgg gagcacgccgacaagctactctccttccagaacaagagaggtggacgcattttactccag gacatcaagaagccagaacgtgatgagtggggcaatgggctggaggccatgcagtgtgct ctgcagctggagaagaatgtgaaccaggccctgctggacctgcacaagattgcctttcac aaggttgacccccatgtaagttatggtggaaccgcacatcacatgtatgtatcacataaa tacaggtactgtcccaggagatga

DBGET integrated database retrieval system