Oncorhynchus nerka (sockeye salmon): 115123565 Help Entry 115123565         CDS       T07952                                  Name (RefSeq) ferritin, middle subunit-like   KO K00522   ferritin heavy chain [EC:1.16.3.1] Organism one  Oncorhynchus nerka (sockeye salmon) Pathway one00860   Porphyrin metabolism one04216   Ferroptosis one04217   Necroptosis Brite KEGG Orthology (KO) [BR:one00001]  09100 Metabolism   09108 Metabolism of cofactors and vitamins    00860 Porphyrin metabolism     115123565  09140 Cellular Processes   09143 Cell growth and death    04216 Ferroptosis     115123565    04217 Necroptosis     115123565  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:one04147]     115123565 Enzymes [BR:one01000]  1. Oxidoreductases   1.16  Oxidizing metal ions    1.16.3  With oxygen as acceptor     1.16.3.1  ferroxidase      115123565 Exosome [BR:one04147]  Exosomal proteins   Exosomal proteins of other body fluids (saliva and urine)    115123565   Exosomal proteins of bladder cancer cells    115123565 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Ferritin Rubrerythrin Motif Other DBs NCBI-GeneID:  115123565 NCBI-ProteinID:  XP_029508767 LinkDB All DBs Position Unknown AA seq 105 aa AA seqDB search MESQIRQNYHHDCEAAINRMINLEMFASYTYTSMAFYFSRDDVALPGFAHFFKENSDEER EHAEKLLSFQNKRGGRILLQDIKKPERDEWGRLRPCSVLCSWRRM NT seq 318 nt NT seq  +upstreamnt  +downstreamnt atggagtctcagatccgccagaactatcaccacgattgcgaagctgctatcaaccggatg atcaacttggagatgtttgcctcctacacctacacttcgatggctttctatttctcccgt gacgatgtggctctgcctggcttcgcgcatttcttcaaggagaacagcgacgaggagcga gagcacgccgaaaaactactctctttccagaacaagagaggtggacgcattttactccag gacatcaagaagccagaacgtgatgagtggggcaggctgaggccatgcagtgtgctctgc agctggagaagaatgtga

DBGET integrated database retrieval system