Oncorhynchus nerka (sockeye salmon): 115127027 Help Entry 115127027         CDS       T07952                                  Name (RefSeq) ferritin, heavy subunit-like   KO K00522   ferritin heavy chain [EC:1.16.3.1] Organism one  Oncorhynchus nerka (sockeye salmon) Pathway one00860   Porphyrin metabolism one04216   Ferroptosis one04217   Necroptosis Brite KEGG Orthology (KO) [BR:one00001]  09100 Metabolism   09108 Metabolism of cofactors and vitamins    00860 Porphyrin metabolism     115127027  09140 Cellular Processes   09143 Cell growth and death    04216 Ferroptosis     115127027    04217 Necroptosis     115127027  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:one04147]     115127027 Enzymes [BR:one01000]  1. Oxidoreductases   1.16  Oxidizing metal ions    1.16.3  With oxygen as acceptor     1.16.3.1  ferroxidase      115127027 Exosome [BR:one04147]  Exosomal proteins   Exosomal proteins of other body fluids (saliva and urine)    115127027   Exosomal proteins of bladder cancer cells    115127027 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Ferritin Rubrerythrin Motif Other DBs NCBI-GeneID:  115127027 NCBI-ProteinID:  XP_029512529 LinkDB All DBs Position Unknown AA seq 142 aa AA seqDB search MGYYFDRDDKSLPNFSKFFLTQSKEEKEHAEKLMSQQNQRGGRIFLQDIKKPDRDEWGSG LEALECALQLEKSVNQSLLDLHKVAVEHNDPHMCDFIETHYLDEQVKSIKELSDWVTNLR RMGAPQNGMAEYLFDKHTLGKE NT seq 429 nt NT seq  +upstreamnt  +downstreamnt atgggctactactttgacagagacgacaaatccctgcccaacttttccaagttcttcctg actcagtccaaggaggagaaggagcatgctgagaaactgatgagtcaacagaaccagaga ggaggacgcatctttctccaggacatcaagaaacctgacagagatgagtggggcagtggg ttggaggccttggagtgtgccctacagctggagaagagtgtcaaccagtctctactggac ctgcacaaagtagccgtagagcacaatgacccgcacatgtgtgacttcatagagacccac tatctggatgagcaggtcaagtctatcaaggagctgagtgactgggtcaccaacctgcgt cgcatgggtgcccctcagaatggcatggcagagtacctcttcgacaagcacaccctgggg aaggagtag

DBGET integrated database retrieval system