Occallatibacter riparius: MOP44_03545 Help Entry MOP44_03545       CDS       T08486                                  Name (GenBank) ferredoxin family protein   KO K00176   2-oxoglutarate ferredoxin oxidoreductase subunit delta [EC:1.2.7.3] Organism orp  Occallatibacter riparius Pathway orp00020   Citrate cycle (TCA cycle) orp01100   Metabolic pathways orp01110   Biosynthesis of secondary metabolites orp01120   Microbial metabolism in diverse environments orp01200   Carbon metabolism orp01210   2-Oxocarboxylic acid metabolism Brite KEGG Orthology (KO) [BR:orp00001]  09100 Metabolism   09101 Carbohydrate metabolism    00020 Citrate cycle (TCA cycle)     MOP44_03545 Enzymes [BR:orp01000]  1. Oxidoreductases   1.2  Acting on the aldehyde or oxo group of donors    1.2.7  With an iron-sulfur protein as acceptor     1.2.7.3  2-oxoglutarate synthase      MOP44_03545 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Fer4_7 Fer4_9 Fer4_21 Fer4 Fer4_6 Fer4_10 Fer4_2 Fer4_4 Fer4_15 Fer4_16 Fer4_22 Fer4_3 Fer4_8 Fer4_13 Motif Other DBs NCBI-ProteinID:  UWZ85023 UniProt:  A0A9J7BR14 LinkDB All DBs Position 900240..900548 Genome browser AA seq 102 aa AA seqDB search MNAQEKLDRGLLRVDEAECKGCGLCIEACPPKVIGLSEGLNHYGYRTAVYAGRGCTGCGI CFLACPEPGALTVYRAVLKRPVAVDRTLGGQSAGGGMACASN NT seq 309 nt NT seq  +upstreamnt  +downstreamnt atgaacgctcaggaaaagctggatcgaggactgctccgcgtggacgaagcggagtgcaag ggatgcgggttgtgcattgaggcatgcccaccgaaggtgattggcctgagcgaggggctg aatcattacggctatcgcacggcggtgtacgcgggcaggggctgcacaggatgcgggatt tgcttcctggcatgccctgagccgggtgcgcttacggtttatcgcgcggtgttgaagcgg ccggttgctgtggatcgaacgctgggcggtcagtcggcagggggaggcatggcatgcgca agcaactga

DBGET integrated database retrieval system