Occallatibacter riparius: MOP44_03545 Help Entry MOP44_03545       CDS       T08486                                  Name (GenBank) ferredoxin family protein   KO K00176   2-oxoglutarate ferredoxin oxidoreductase subunit delta [EC:1.2.7.3] Organism orp  Occallatibacter riparius Pathway orp00020   Citrate cycle (TCA cycle) orp00720   Other carbon fixation pathways orp01100   Metabolic pathways orp01110   Biosynthesis of secondary metabolites orp01120   Microbial metabolism in diverse environments orp01200   Carbon metabolism orp01210   2-Oxocarboxylic acid metabolism Brite KEGG Orthology (KO) [BR:orp00001]  09100 Metabolism   09101 Carbohydrate metabolism    00020 Citrate cycle (TCA cycle)     MOP44_03545   09102 Energy metabolism    00720 Other carbon fixation pathways     MOP44_03545 Enzymes [BR:orp01000]  1. Oxidoreductases   1.2  Acting on the aldehyde or oxo group of donors    1.2.7  With an iron-sulfur protein as acceptor     1.2.7.3  2-oxoglutarate synthase      MOP44_03545 SSDB OrthologParalogGFIT Motif Pfam:  Fer4_7 Fer4_21 Fer4_6 Fer4 Fer4_9 Fer4_10 Fer4_2 Fer4_4 Fer4_15 LdpA_Fe-S-bd Fer4_16 Fer4_22 Fer4_3 Fer4_8 Fer4_13 Motif Other DBs NCBI-ProteinID:  UWZ85023 UniProt:  A0A9J7BR14 LinkDB All DBs Position 900240..900548 Genome browser AA seq 102 aa AA seqDB search MNAQEKLDRGLLRVDEAECKGCGLCIEACPPKVIGLSEGLNHYGYRTAVYAGRGCTGCGI CFLACPEPGALTVYRAVLKRPVAVDRTLGGQSAGGGMACASN NT seq 309 nt NT seq  +upstreamnt  +downstreamnt atgaacgctcaggaaaagctggatcgaggactgctccgcgtggacgaagcggagtgcaag ggatgcgggttgtgcattgaggcatgcccaccgaaggtgattggcctgagcgaggggctg aatcattacggctatcgcacggcggtgtacgcgggcaggggctgcacaggatgcgggatt tgcttcctggcatgccctgagccgggtgcgcttacggtttatcgcgcggtgttgaagcgg ccggttgctgtggatcgaacgctgggcggtcagtcggcagggggaggcatggcatgcgca agcaactga

DBGET integrated database retrieval system