Odoribacter splanchnicus: Odosp_3202 Help Entry Odosp_3202        CDS       T01428                                  Name (GenBank) putative ferredoxin 4Fe-4S   KO K00176   2-oxoglutarate ferredoxin oxidoreductase subunit delta [EC:1.2.7.3] Organism osp  Odoribacter splanchnicus Pathway osp00020   Citrate cycle (TCA cycle) osp01100   Metabolic pathways osp01110   Biosynthesis of secondary metabolites osp01120   Microbial metabolism in diverse environments osp01200   Carbon metabolism osp01210   2-Oxocarboxylic acid metabolism Brite KEGG Orthology (KO) [BR:osp00001]  09100 Metabolism   09101 Carbohydrate metabolism    00020 Citrate cycle (TCA cycle)     Odosp_3202 Enzymes [BR:osp01000]  1. Oxidoreductases   1.2  Acting on the aldehyde or oxo group of donors    1.2.7  With an iron-sulfur protein as acceptor     1.2.7.3  2-oxoglutarate synthase      Odosp_3202 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Fer4 Fer4_7 Fer4_2 Fer4_21 Fer4_10 Fer4_9 Fer4_6 Fer4_16 Fer4_15 Fer4_4 Fer4_13 Fer4_22 Fer4_17 Fer4_8 Fer4_3 Motif Other DBs NCBI-ProteinID:  ADY34161 UniProt:  F9Z8E8 LinkDB All DBs Position complement(3809286..3809513) Genome browser AA seq 75 aa AA seqDB search MAKFRGAIVVDTEHCKGCSLCVVACPTKVIELNPDVNGKGYHYAYMKNPEACIGCASCGL VCPDSVITVYKKNVE NT seq 228 nt NT seq  +upstreamnt  +downstreamnt atggcaaaattcagaggagcaattgttgtagacaccgaacattgcaaaggatgtagtctg tgtgtcgtagcatgtccgactaaagtgatcgagctgaatccggatgtaaacggaaagggt tatcactatgcttatatgaaaaatcccgaagcttgtatcggctgtgcgagctgtggtctg gtatgtcccgactctgtaatcactgtctataaaaaaaatgtagaataa

DBGET integrated database retrieval system