Opitutus terrae: Oter_1960 Help Entry Oter_1960         CDS       T00689                                  Name (GenBank) MbtH domain protein   KO K05375   MbtH protein Organism ote  Opitutus terrae Pathway ote00261   Monobactam biosynthesis ote01100   Metabolic pathways ote01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:ote00001]  09100 Metabolism   09110 Biosynthesis of other secondary metabolites    00261 Monobactam biosynthesis     Oter_1960  09180 Brite Hierarchies   09181 Protein families: metabolism    01008 Polyketide biosynthesis proteins [BR:ote01008]     Oter_1960 Polyketide biosynthesis proteins [BR:ote01008]  Nonribosomal peptide synthetase (NRPS)   Linear NRPS    Nocardicin synthetase     Oter_1960 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  MbtH Motif Other DBs NCBI-ProteinID:  ACB75243 UniProt:  B1ZYK7 LinkDB All DBs Position complement(2457569..2457787) Genome browser AA seq 72 aa AA seqDB search MSAESENDSTRYHVVLNDEEQYSIWPVDLPIPGGWRHDGTTGTKPECLAHIKAVWTDMTP ASLRRARNAATP NT seq 219 nt NT seq  +upstreamnt  +downstreamnt atgtccgcagaatcggagaacgactccacccgttaccacgtcgtgttgaacgatgaggag cagtattcaatctggcccgtcgatctgccgattcccggcggttggcggcacgacggcaca acggggacgaagccggagtgcctcgcccacatcaaggcggtgtggaccgacatgacgccg gccagcttgcgccgggcgcgcaacgccgcgacgccgtga

DBGET integrated database retrieval system