Pseudomonas aeruginosa PAO1: PA2412 Help Entry PA2412            CDS       T00035                                  Name (RefSeq) hypothetical protein   KO K05375   MbtH protein Organism pae  Pseudomonas aeruginosa PAO1 Pathway pae00261   Monobactam biosynthesis pae01100   Metabolic pathways pae01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:pae00001]  09100 Metabolism   09110 Biosynthesis of other secondary metabolites    00261 Monobactam biosynthesis     PA2412  09180 Brite Hierarchies   09181 Protein families: metabolism    01008 Polyketide biosynthesis proteins [BR:pae01008]     PA2412 Polyketide biosynthesis proteins [BR:pae01008]  Nonribosomal peptide synthetase (NRPS)   Linear NRPS    Nocardicin synthetase     PA2412 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  MbtH Motif Other DBs NCBI-GeneID:  878774 NCBI-ProteinID:  NP_251102 UniProt:  Q9I169 Structure PDB LinkDB All DBs Position complement(2694546..2694764) Genome browser AA seq 72 aa AA seqDB search MTSVFDRDDIQFQVVVNHEEQYSIWPEYKEIPQGWRAAGKSGLKKDCLAYIEEVWTDMRP LSLRQHMDKAAG NT seq 219 nt NT seq  +upstreamnt  +downstreamnt atgacttcagtgttcgaccgtgacgacatccagttccaggtagtggtcaaccatgaggag cagtattccatctggccggaatacaaggagattccccagggctggcgggcggccggcaag agcggcctgaagaaggactgcctggcctacatcgaggaagtctggaccgacatgcgcccg ctgagcctgcgccagcacatggacaaggcggccggctga

DBGET integrated database retrieval system