Pseudomonas aeruginosa c7447m: M802_2481 Help Entry M802_2481         CDS       T03098                                  Name (GenBank) mbtH-like family protein   KO K05375   MbtH protein Organism paec  Pseudomonas aeruginosa c7447m Pathway paec00261   Monobactam biosynthesis paec01100   Metabolic pathways paec01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:paec00001]  09100 Metabolism   09110 Biosynthesis of other secondary metabolites    00261 Monobactam biosynthesis     M802_2481  09180 Brite Hierarchies   09181 Protein families: metabolism    01008 Polyketide biosynthesis proteins [BR:paec01008]     M802_2481 Polyketide biosynthesis proteins [BR:paec01008]  Nonribosomal peptide synthetase (NRPS)   Linear NRPS    Nocardicin synthetase     M802_2481 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  MbtH Motif Other DBs NCBI-ProteinID:  AGV66842 LinkDB All DBs Position complement(2693054..2693272) Genome browser AA seq 72 aa AA seqDB search MTSVFDRDDIQFQVVVNHEEQYSIWPEYKEIPQGWRAAGKSGLKKDCLAYIEEVWTDMRP LSLRQHMDKAAG NT seq 219 nt NT seq  +upstreamnt  +downstreamnt atgacttcagtgttcgaccgtgacgacatccagttccaggtagtggtcaaccatgaggag cagtattccatctggccggaatacaaggagattccccagggctggcgggcggccggcaag agcggcctgaagaaggactgcctggcctacatcgaggaagtctggaccgacatgcgcccg ctgagcctgcgccagcacatggacaaggcggccggctga

DBGET integrated database retrieval system