Pseudomonas aeruginosa PA1R: PA1R_gp0213 Help Entry PA1R_gp0213       CDS       T02929                                  Name (GenBank) putative MbtH-like protein   KO K05375   MbtH protein Organism paer  Pseudomonas aeruginosa PA1R Pathway paer00261   Monobactam biosynthesis paer01100   Metabolic pathways paer01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:paer00001]  09100 Metabolism   09110 Biosynthesis of other secondary metabolites    00261 Monobactam biosynthesis     PA1R_gp0213  09180 Brite Hierarchies   09181 Protein families: metabolism    01008 Polyketide biosynthesis proteins [BR:paer01008]     PA1R_gp0213 Polyketide biosynthesis proteins [BR:paer01008]  Nonribosomal peptide synthetase (NRPS)   Linear NRPS    Nocardicin synthetase     PA1R_gp0213 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  MbtH Motif Other DBs NCBI-ProteinID:  AHA21990 LinkDB All DBs Position complement(276365..276583) Genome browser AA seq 72 aa AA seqDB search MTSVFDRDDIQFQVVVNHEEQYSIWPEYKEIPQGWRAAGKSGLKKDCLAYIEEVWTDMRP LSLRQHMDKAAG NT seq 219 nt NT seq  +upstreamnt  +downstreamnt atgacttcagtgttcgaccgtgacgacatccagttccaggtagtggtcaaccatgaggag cagtattccatctggccggaatacaaggagattccccagggctggcgggcggccggcaag agcggcctgaagaaggactgcctggcctacatcgaggaagtctggaccgacatgcgcccg ctgagcctgcgccagcacatggacaaggcggccggctga

DBGET integrated database retrieval system