Pseudomonas aeruginosa SCV20265: SCV20265_2906 Help Entry SCV20265_2906     CDS       T02971                                  Name (GenBank) putative MbtH-like protein   KO K05375   MbtH protein Organism paes  Pseudomonas aeruginosa SCV20265 Pathway paes00261   Monobactam biosynthesis paes01100   Metabolic pathways paes01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:paes00001]  09100 Metabolism   09110 Biosynthesis of other secondary metabolites    00261 Monobactam biosynthesis     SCV20265_2906  09180 Brite Hierarchies   09181 Protein families: metabolism    01008 Polyketide biosynthesis proteins [BR:paes01008]     SCV20265_2906 Polyketide biosynthesis proteins [BR:paes01008]  Nonribosomal peptide synthetase (NRPS)   Linear NRPS    Nocardicin synthetase     SCV20265_2906 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  MbtH Motif Other DBs NCBI-ProteinID:  AHC77020 LinkDB All DBs Position 3057177..3057395 Genome browser AA seq 72 aa AA seqDB search MTSVFDRDDIQFQVVVNHEEQYSIWPEYKEIPQGWRAAGKSGLKKDCLAYIEEVWTDMRP LSLRQHMDKAAG NT seq 219 nt NT seq  +upstreamnt  +downstreamnt atgacttcagtgttcgaccgtgacgacatccagttccaggtagtggtcaaccatgaggag cagtattccatctggccggaatacaaggagattccccagggctggcgggcggccggcaag agcggcctgaagaaggactgcctggcctacatcgaggaagtctggaccgacatgcgcccg ctgagcctgcgccagcacatggacaaggcggccggctga

DBGET integrated database retrieval system