Pseudomonas aeruginosa PA38182: BN889_02633 Help Entry BN889_02633       CDS       T03031                                  Name (GenBank) putative MbtH-like protein   KO K05375   MbtH protein Organism paeu  Pseudomonas aeruginosa PA38182 Pathway paeu00261   Monobactam biosynthesis paeu01100   Metabolic pathways paeu01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:paeu00001]  09100 Metabolism   09110 Biosynthesis of other secondary metabolites    00261 Monobactam biosynthesis     BN889_02633  09180 Brite Hierarchies   09181 Protein families: metabolism    01008 Polyketide biosynthesis proteins [BR:paeu01008]     BN889_02633 Polyketide biosynthesis proteins [BR:paeu01008]  Nonribosomal peptide synthetase (NRPS)   Linear NRPS    Nocardicin synthetase     BN889_02633 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  MbtH Motif Other DBs NCBI-ProteinID:  CDI90691 LinkDB All DBs Position complement(2766434..2766652) Genome browser AA seq 72 aa AA seqDB search MTSVFDRDDIQFQVVVNHEEQYSIWPEYKEIPQGWRAAGKSGLKKDCLAYIEEVWTDMRP LSLRQHMDKAAG NT seq 219 nt NT seq  +upstreamnt  +downstreamnt atgacttcagtgttcgaccgtgacgacatccagttccaggtagtggtcaaccatgaggag cagtattccatctggccggaatacaaggagattccccagggctggcgggcggccggcaag agcggcctgaagaaggactgcctggcctacatcgaggaagtctggaccgacatgcgcccg ctgagcctgcgccagcacatggacaaggcggccggctga

DBGET integrated database retrieval system